in vitro activity a susceptibilty testing

Báo cáo Y học: A Ca2+/CaM-dependent kinase from pea is stress regulated and in vitro phosphorylates a protein that binds to AtCaM5 promoter ppt

Báo cáo Y học: A Ca2+/CaM-dependent kinase from pea is stress regulated and in vitro phosphorylates a protein that binds to AtCaM5 promoter ppt

... 5¢-AAACCAGCCATGAATGAAAT-3¢) and with actin primers (forward primer: 5¢-GTTGGGAT GAACCAGAAGGA-3¢; reverse primer: 5¢-GAACCA CCGATCCAGACACT-3¢) as a control Reactions with no DNA added served as a ... promoter fragment The sequences of the oligonucleotides used for these experiments are: Oligo I, 5¢-CAAGGACGTTCGATGCA CTTCCAAAAAACATATAAT-3¢; Oligo II, 5¢-CAAT GTAGTATTAAAAAGTAGTAGTTAAAAGC-3¢; Oligo ... light-regulated gravitropism Planta 199, 18–24 20 Takezawa, D., Ramachandiran, S., Paranjape, V & Poovaiah, B.W (1996) Dual regulation of a chimeric plant serine/threonine kinase by calcium and calcium/calmodulin...

Ngày tải lên: 18/03/2014, 01:20

12 365 0
Ultrasonography in In Vitro FertilizationRoger A. PiersonDepartment of Obstetrics, Gynecology pptx

Ultrasonography in In Vitro FertilizationRoger A. PiersonDepartment of Obstetrics, Gynecology pptx

... preovulatory follicles are characterized by increased heterogeneity, increased wall breadth, and a more gradual transformation at the fluid– follicle wall interface Atresia is characterized by thin ... randomized clinical trial Hum Reprod 2002; 17:2885–2890 116 Pierson 153 Garcia-Velasco JA, Isaza V, Martinez-Salazar J Transabdominal ultrasoundguided embryo transfer does not increase pregnancy ... Retrievals were done laparoscopically or using ultrasound guidance from transurethral, transvesicular, or transabdominal approaches (48,51,55–58) The advent of transvaginal transducers and concerted...

Ngày tải lên: 05/08/2014, 16:20

26 178 0
Báo cáo khoa học:" In vitro host range, multiplication and virion forms of recombinant viruses obtained from co-infection in vitro with a vaccinia-vectored influenza vaccine and a naturally occurring cowpox virus isolate" pot

Báo cáo khoa học:" In vitro host range, multiplication and virion forms of recombinant viruses obtained from co-infection in vitro with a vaccinia-vectored influenza vaccine and a naturally occurring cowpox virus isolate" pot

... Nemeckova S, Hainz P, Otahal P, Gabriel P, Sroller V, Kutinova L: Early gene expression of vaccinia virus strains replicating (Praha) and non-replicating (modified vaccinia virus strain Ankara, MVA) ... (CRL-1573) Rat/small intestine; normal Hamster syrian/kidney; normal Human/colon; colorectal adenocarcinoma Rat/liver; hepatoma Human/small intestine; normal Human/duodenum; adenocarcinoma African Green ... glutinin viral Cellularprotein localization of the influenza virus haemagCellular and viral localization of the influenza virus haemagglutinin protein Vero cells were infected with MVA-HANP and HA...

Ngày tải lên: 12/08/2014, 04:21

13 377 0
Báo cáo khoa học: " In vitro host range, multiplication and virion forms of recombinant viruses obtained from co-infection in vitro with a vaccinia-vectored influenza vaccine and a naturally occurring cowpox virus isolate" pps

Báo cáo khoa học: " In vitro host range, multiplication and virion forms of recombinant viruses obtained from co-infection in vitro with a vaccinia-vectored influenza vaccine and a naturally occurring cowpox virus isolate" pps

... Nemeckova S, Hainz P, Otahal P, Gabriel P, Sroller V, Kutinova L: Early gene expression of vaccinia virus strains replicating (Praha) and non-replicating (modified vaccinia virus strain Ankara, MVA) ... (CRL-1573) Rat/small intestine; normal Hamster syrian/kidney; normal Human/colon; colorectal adenocarcinoma Rat/liver; hepatoma Human/small intestine; normal Human/duodenum; adenocarcinoma African Green ... glutinin viral Cellularprotein localization of the influenza virus haemagCellular and viral localization of the influenza virus haemagglutinin protein Vero cells were infected with MVA-HANP and HA...

Ngày tải lên: 12/08/2014, 04:21

13 294 0
Báo cáo khoa học: The C-terminal region of the proprotein convertase 1⁄ 3 (PC1⁄ 3) exerts a bimodal regulation of the enzyme activity in vitro pdf

Báo cáo khoa học: The C-terminal region of the proprotein convertase 1⁄ 3 (PC1⁄ 3) exerts a bimodal regulation of the enzyme activity in vitro pdf

... polypeptide was characterized by western blotting, amino acid analysis and N-terminal Edman sequencing (data not shown) MS analysis showed that the isolated CT-peptide had a molecular mass within Da of ... kDa form (71 kDa in the recombinant insectproduced form) The appearance of an intermediate molecular form can also be seen as a 74 kDa protein Both C-terminal cleavages were proposed to be accomplished ... N- and C-terminal propeptides has been documented in the leucine aminopeptidase from Aeromonas proteolytica [20] Similarly, in Arg-gingipain [21] and Asn-endopeptidase [22], sequential removal...

Ngày tải lên: 30/03/2014, 08:20

10 305 0
Báo cáo y học: "Pre-clinical development as microbicide of zinc tetra-ascorbo-camphorate, a novel terpenoid derivative: Potent in vitro inhibitory activity against both R5- and X4-tropic HIV-1 strains without significant in vivo mucosal toxicity" docx

Báo cáo y học: "Pre-clinical development as microbicide of zinc tetra-ascorbo-camphorate, a novel terpenoid derivative: Potent in vitro inhibitory activity against both R5- and X4-tropic HIV-1 strains without significant in vivo mucosal toxicity" docx

... and parts of the upper (cervicovagina), middle (midvagina), and lower (urovagina) areas of each vagina were fixed with formalin and paraffin embedded by standard histological examination To assess ... pharmacological activities, such as antimalarial and anti-inflammatory activities[7] BA and its derivatives have demonstrated high anti-HIV-1 activity and cytotoxicity against a variety of tumor cell lines ... euthanized by intravenous injection of sodium pentobarbital, in accordance with the guidelines of the American Veterinary Medical Association Panel on Euthanasia The vaginal tracts were surgically...

Ngày tải lên: 10/08/2014, 05:21

11 480 0
Báo cáo y học: "The triple combination of tenofovir, emtricitabine and efavirenz shows synergistic anti-HIV-1 activity in vitro: a mechanism of action study" pdf

Báo cáo y học: "The triple combination of tenofovir, emtricitabine and efavirenz shows synergistic anti-HIV-1 activity in vitro: a mechanism of action study" pdf

... (5'-CTGAGACAACATCTGCTGAGGTAGG), and D26 (5'-CTGAGACAACATCTG CTGAGGTA GGA), and templates D3 6A (3'-CGAAAGTCCAGGGA CA AGCCCGCGGTG TGTATCTCT), D36C (3'-CGAAAGTC- Page of 16 (page number not for citation ... starting concentration for each compound was fixed at 3–4 fold above the individual drug IC50 value Isobologram analysis The isobologram analysis is a graphical approach that can be traced back ... three-dimensional graph with their corresponding drug combinations Areas of the graph blow zero indicate antagonism, whereas areas above zero indicate synergy A synergy volume is calculated by adding all...

Ngày tải lên: 12/08/2014, 23:21

16 378 0
Survey of cellular factors modulating the HIV 1 integration complex activity using a unique protein screening system in vitro

Survey of cellular factors modulating the HIV 1 integration complex activity using a unique protein screening system in vitro

... An additional PCR was performed using a common set of forward (5’GGGGACAAGTTTGTACAAAAAAGCAGGCTgcgaattcatcgatagatctgat-3) and reverse (5’GGGGACCACTTTGTACAAGAAAGCTGGGTCctacttgtcatcgtcatccttg-3’) ... with DNA Facilitate chromatin engagement by viral cDNA before integration Phosphorylates BAF causing its dissociation from PIC and affecting strand-transfer Emerin VRK1 Vacciniarelated kinases ... integration assay via displacement of IN Co-immunoAcetylates IN to precipitation enhance DNA affinity and integration Yeast twoInhibits integration hybrid screening by decreasing IN acetylation References...

Ngày tải lên: 01/10/2015, 17:27

125 395 0
Tài liệu Báo cáo khoa học: Proteolysis of Pseudomonas exotoxin A within hepatic endosomes by cathepsins B and D produces fragments displaying in vitro ADP-ribosylating and apoptotic effects doc

Tài liệu Báo cáo khoa học: Proteolysis of Pseudomonas exotoxin A within hepatic endosomes by cathepsins B and D produces fragments displaying in vitro ADP-ribosylating and apoptotic effects doc

... analysis with the antibody against ETA revealed that the endosomal ETA-degrading activity was partially inhibited by the aspartic acid protease inhibitor pepstatin -A (PA), the cysteine protease ... GWEQLEQCGYPVQRLVALYLAARLSWNQVDQV IRNALASPGSGGDLGEAIREQPEQARLALTLAAAESERFVRQGTGNDEAGAANADVVSLTCP VAAGECAGPADSGDALLERNYPTGAEFLGDGGDVSFSTRGTQNWTVERLLQAHRQLEERGYV FVGYHGTFLEAAQSIVFGGVRARSQDLDAIWRGFYIAGDPALAYGYAQDQEPDARGRIRNGA ... kDa) ETA -A – 25 – 37 – 25 – 15 – 15 kDa kDa Fig Kinetics of appearance of ETA in hepatic plasma membranes and endosomes after toxin administration Rat hepatic plasma membrane (A) and endosomal...

Ngày tải lên: 18/02/2014, 04:20

15 588 0
Tài liệu Báo cáo khoa học: Phosphorylation of hormone-sensitive lipase by protein kinase A in vitro promotes an increase in its hydrophobic surface area ppt

Tài liệu Báo cáo khoa học: Phosphorylation of hormone-sensitive lipase by protein kinase A in vitro promotes an increase in its hydrophobic surface area ppt

... that HSL gains accessible hydrophobic surface area upon PKA phosphorylation This gain in hydrophobic surface area presumably accounts for the increase in in vitro activity of HSL following PKA ... and that this is followed by an interaction between the apolar acyl chains of the phospholipids and side chains of particular amino acids, thus accounting for the increased capacity to penetrate ... purification of C-terminal His-tagged recombinant rat adipocyte HSL To generate a recombinant baculovirus encoding C-terminally tagged rat adipocyte HSL, full-length rat adipocyte HSL cDNA, including...

Ngày tải lên: 18/02/2014, 11:20

11 562 0
Tài liệu Báo cáo khoa học: Trophoblast-like human choriocarcinoma cells serve as a suitable in vitro model for selective cholesteryl ester uptake from high density lipoproteins pdf

Tài liệu Báo cáo khoa học: Trophoblast-like human choriocarcinoma cells serve as a suitable in vitro model for selective cholesteryl ester uptake from high density lipoproteins pdf

... (primer A and C, not shown) was abundantly present in JAr and Jeg3 cells while only negligible amounts became apparent in BeWo cells In parallel (using primers A and C) a faint 540 bp band (indicative ... cell association and degradation of 125I-labeled Table Specific binding of 125I-labeled HDL to choriocarcinoma cell lines at °C Binding constants were calculated by non linear regression analysis ... island and cell columns, is formed which maintains the ability of proliferation and invasion Choriocarcinoma is a malignant neoplasm that represents the early trophoblast of the attachment phase...

Ngày tải lên: 20/02/2014, 23:20

12 470 0
Báo cáo khoa học: Two types of replication protein A in seed plants Characterization of their functions in vitro and in vivo ppt

Báo cáo khoa học: Two types of replication protein A in seed plants Characterization of their functions in vitro and in vivo ppt

... F1 (ATGGAGAACTCAGT GACCCAAGATGGTAT) and 70b R1 (AGAATTCTGAG GTTGAAGAAGCTAGTAA) primers, and 70b F2 (TACT ATCAGCAGAAGCAATGTGGTGATA) and 70b R2 (TTACTGAGATGTCTTGTTCTTGGAAATGT) primers for atrpa70b ... mutants of A thaliana are already available [26] We were able to obtain one T-DNA insertion line each for AtRPA7 0a and AtRPA70b (Fig 1A) The T-DNA insertion in AtRPA7 0a (atrpa7 0a) was lethal, ... DNA binding and chromatin association of ATR (ataxia telangiectasia-mutated and Rad3-related) in vitro via ATR interacting protein [4,22,23] Rad17 and Rad9 complexes (Rad17–RFC2–5 and Rad9–Rad1–Hus1)...

Ngày tải lên: 07/03/2014, 21:20

12 588 0
Báo cáo khoa học: Concerted mutation of Phe residues belonging to the b-dystroglycan ectodomain strongly inhibits the interaction with a-dystroglycan in vitro pot

Báo cáo khoa học: Concerted mutation of Phe residues belonging to the b-dystroglycan ectodomain strongly inhibits the interaction with a-dystroglycan in vitro pot

... Ala reverse GTTAGTAGGTGAGAAATCGGCGGTTCAGTTTAACAGCAACA TGTTGCTGTTAAACTGAACCGCGCATTTCTCACCTACTAAC GAGAAATCGTGGGTTCAGGCCAACAGCAACAGCCAGCTC GAGCTGGCTGTTGCTGTTGGCCTGAACCCACGATTTCTC TCGTGGGTTCAGTTTAACAGCAACAGCCAGCTC ... TCGTGGGTTCAGTTTAACAGCAACAGCCAGCTC GAGCTGGCTGTTGCTGTTAAACTGAACCCACGA TCTGCCCCTGGAGCCCTGCCCCA TGGGGCAGGGCTCCAGGGGCAGA CCTCGTCCTGCCGCCTCCAATGCTCTGGA TCCAGAGCATTGGAGGCGGCAGGACGAGG GCTCTGGAGCCTGACGCCAAGGCTCTGAGTATTGC ... murine DG gene harboring the mutations Trp551 fi Ala, Phe554 fi Ala, Phe692 fi Ala, Asn555 fi Ala, Glu667 fi Ala, Phe700 fi Ala, Phe718 fi Ala, Val736 fi Ala and Phe692 fi Ala ⁄ Phe718 fi Ala Cell-staining...

Ngày tải lên: 16/03/2014, 12:20

15 337 0
Báo cáo khoa học: In vitro gamma-secretase cleavage of the Alzheimer’s amyloid precursor protein correlates to a subset of presenilin complexes and is inhibited by zinc potx

Báo cáo khoa học: In vitro gamma-secretase cleavage of the Alzheimer’s amyloid precursor protein correlates to a subset of presenilin complexes and is inhibited by zinc potx

... 5549 Characterization of in vitro c-secretase activity in the megaDalton range and suggest that only a subset of PS-containing c-secretase complexes are enzymatically active Gamma-secretase activity ... 3FLAG HindIII creating the plasmid c-3FLAG standard Finally, the primer pairs forward, 5¢-GGGGGGCCATGGTGATGCTGA AGAAGAACAG-3¢ and reverse 3FLAG HindIII were used to generate the plasmid e-3FLAG ... C101-3FLAG as an a- CTF within 27 Da of the calculated molecular mass Finally the same line was used to predict the molecular mass of a third FLAG-reactive protein between alpha and c-3FLAG proteins as...

Ngày tải lên: 16/03/2014, 23:20

14 421 0
Báo cáo khoa học: Initiation of JC virus DNA replication in vitro by human and mouse DNA polymerase a-primase ppt

Báo cáo khoa học: Initiation of JC virus DNA replication in vitro by human and mouse DNA polymerase a-primase ppt

... creatine kinase, 0.25 mgÆmL)1 heat treated BSA, and lCi [a- 32P]dCTP and lCi [a- 32P]dTTP (each 3000 CiÆmmol)1, AmershamBiosciences) Recombinant DNA polymerase a- primase was added as indicated After ... [a3 2P]dCTP and [a3 2P]dTTP (3000 CiÆmmol)1, AmershamBiosciences) DNA polymerase a- primase was added as indicated The incorporation of radioactive dNMP was measured by acid-precipitation of DNA and scintillation ... Sawa, H., Komagome, R., Orba, Y., Yamada, M., Okada, Y., Ishida, Y., Nishihara, H., Tanaka, S & Nagashima, K (2001) Broad distribution of the JC virus receptor contrasts with a marked cellular...

Ngày tải lên: 17/03/2014, 03:20

8 326 0
Báo cáo khoa học: NovelN,N¢-diacyl-1,3-diaminopropyl-2-carbamoyl bivalent cationic lipids for gene delivery – synthesis,in vitro transfection activity, and physicochemical characterization docx

Báo cáo khoa học: NovelN,N¢-diacyl-1,3-diaminopropyl-2-carbamoyl bivalent cationic lipids for gene delivery – synthesis,in vitro transfection activity, and physicochemical characterization docx

... vectors, a conformational isomer and a monovalent analog [12] It was determined that a symmetrical bivalent pH-expandable polar headgroup, in combination with greater intramolecular space between ... HendersonHasselbach equation, which contains an adjustable parameter C that affects the slope of the transition region In the original equation, this parameter is equal to for a univalent base (and ... compressed at a constant rate of 10 mmặmin)1 Plots of surface pressure (p) against mean molecular area (A) were automatically generated Molecular compressibility was assessed from rst-derivative analysis...

Ngày tải lên: 23/03/2014, 07:20

15 319 0
Báo cáo khoa học: RNA reprogramming of a-mannosidase mRNA sequences in vitro by myxomycete group IC1 and IE ribozymes pptx

Báo cáo khoa học: RNA reprogramming of a-mannosidase mRNA sequences in vitro by myxomycete group IC1 and IE ribozymes pptx

... GCCCGATGCCGACAGCA GCCCGATGCCGACAGCAGAATGGTTTCACGAACAAGACGTTTGGCAAAACCCTTTATACCAGCCTCCCTTGGGCA GCCCGATGCCGACAGCAGAATGGTTTCACGAACAAGACGTTTGGCAAAACCGAGTACTCCAAAACTAATCAATAT GGGAATTAATACGACTCACTATAGGNNNNNAAAAGTTATCAGGCATGCACCT ... GGGAATTAATACGACTCACTATAGGNNNNNAAAAGTTATCAGGCATGCACCT GGGAATTAATACGACTCACTATAGGNNNNNGATAGTCAGCATGTACGCTGGC GGGAATTAATACGACTCACTATAGGNNNNTAAAAGCAACTAGAAATAGCGT GGGAATTAATACGACTCACTATAGGNNNNAGGGGACCTTGCAAGTCCCCTA GCCCGATGCCGACAGCAGAATGGTTTCACGAACAAGACGTTTGGCAAAACCGGTATGCGCTTAGCCTTAGAC ... GCCCGATGCCGACAGCAGAATGGTTTCACGAACAAGACGTTTGGCAAAACCGGTATGCGCTTAGCCTTAGAC GCCCGATGCCGACAGCAGAATGGTTTCACGAACAAGACGTTTGGCAAAACCCTTTGTACCGACCTCCGCCAA CAGCAGAATGGTTTCACG CAGAAGCTCATCCGGCTG AGCATCACGACGCCGTCA...

Ngày tải lên: 23/03/2014, 11:20

12 334 0
Báo cáo khoa học: Determination of the reopening temperature of a DNA hairpin structure in vitro pptx

Báo cáo khoa học: Determination of the reopening temperature of a DNA hairpin structure in vitro pptx

... slow (Fig 2B, lane 3) or fast (Fig 2B, lanes and 4) annealing These data taken together indicate that the hairpin-forming region (as indicated in Fig 1A) can indeed affect primer DNA primer extension, ... can be applied for a local sequence analysis (e.g of a single hairpin structure) it will become inaccurate for certain DNA hairpin loops For example, a CG closing base pair enhances stability ... 5¢-ATGGCCTGAG*AGCCACCC-3¢ (G* as the marker); and primer 3: 5¢-TCAG*AGGCCACAAACCA CAC-3¢ (G* as the marker) were synthesized using an Applied Biosystems DNA synthesiser The markers indicated in each oligonucleotide...

Ngày tải lên: 23/03/2014, 13:20

6 428 0
Báo cáo khoa học: Protein kinase Ch activity is involved in the 2,3,7,8tetrachlorodibenzo-p-dioxin-induced signal transduction pathway leading to apoptosis in L-MAT, a human lymphoblastic T-cell line potx

Báo cáo khoa học: Protein kinase Ch activity is involved in the 2,3,7,8tetrachlorodibenzo-p-dioxin-induced signal transduction pathway leading to apoptosis in L-MAT, a human lymphoblastic T-cell line potx

... PKCh kinase activity in vitro The kinase assay was performed by using 10 ng of a purified human recombinant PKCh enzyme in a reaction mixture that contained 50 lM ATP, 40 lM of a biotinylated PKCh ... N-terminal kinase (JNK1) is rapidly activated in L-MAT cells, and that a dominant negative mutant of JNK prevented TCDD-induced cell death [7] Ghaffari-Tabrizi et al and others have demonstrated ... HRP-conjugated antibody (goat polyclonal; Santa Cruz Biotechnology Inc.) at room temperature Finally, the signal was detected as described above In vitro kinase assay for nPKC A biotinylated PKCh...

Ngày tải lên: 23/03/2014, 13:20

13 426 0
Báo cáo khoa học: Identification of a preferred substrate peptide for transglutaminase 3 and detection of in situ activity in skin and hair follicles pdf

Báo cáo khoa học: Identification of a preferred substrate peptide for transglutaminase 3 and detection of in situ activity in skin and hair follicles pdf

... Tgases, including TGase In addition, at the N-terminal side of the glutamine residue including position -1, bulk amino acid residues such as tyrosine, proline and phenylalanine are located in ... then stained using standard methods and analyzed with a microscope, BZ-8100 (Keyence, Osaka, Japan) Acknowledgements We greatly appreciate Dr Masatoshi Maki and Dr Hideki Shibata in our laboratory ... surrounding the reactive glutamine residues are critical in the formation of an intermediate enzyme–substrate complex Each isozyme in the TGase family, mainly characterized as TGase 1, TGase and Factor...

Ngày tải lên: 29/03/2014, 21:20

11 645 0
w