if there are elements in a sentence that are parallel in meaning and in grammatical function make them parallel in grammatical form

Báo cáo khoa học: Purification of a plant nucleotide pyrophosphatase as a protein that interferes with nitrate reductase and glutamine synthetase assays pdf

Báo cáo khoa học: Purification of a plant nucleotide pyrophosphatase as a protein that interferes with nitrate reductase and glutamine synthetase assays pdf

Ngày tải lên : 08/03/2014, 08:20
... methods) and run on SDS/PAGE and stained with Coomassie blue Molecular mass standards (in kDa) are phosphorylase (97), bovine serum albumin (66), ovalbumin (43), carbonic anhydrase (30) and soybean ... production of AMP from NADH, ATP and FAD (Table 3) Ninety percent of the amount of NADH used in our standard NR assay, and 60% of the amount of ATP in a GS assay, was converted into AMP within 10 at 30 ... which was run parallel to each assay The assays which contained ATP in stage I were diluted 100-fold for stage II All assays were performed at least in duplicate NADH oxidase in a desalted, cell-free...
  • 7
  • 457
  • 0
clear blogging how people blogging are changing the world and how you can join them

clear blogging how people blogging are changing the world and how you can join them

Ngày tải lên : 31/05/2014, 23:30
... conversational marketing is really engaging in a dialog with an audience, and having that be a form of marketing Q What is the big advantage of conversational marketing? A The big advantage of ... What’s going to drive that? That s a fairly major change in behavior there A I think what is going to drive that is that the consumers are going to want them to come down from the mountaintop and ... Francisco Bay Area for the past 23 years, specializing in desktop information systems His company, Safari Software, Inc., has for the past decade amazingly focused on the same thing, albeit at...
  • 360
  • 545
  • 0
a systemic funtional perspective on the meaning and structure of the story  the selfish giant  by oscar wilde = bình diện ngữ pháp chức năng hệ thống về cấu trúc và ngữ nghĩa của truyện ngắn gã khổng lồ ích kỷ

a systemic funtional perspective on the meaning and structure of the story the selfish giant by oscar wilde = bình diện ngữ pháp chức năng hệ thống về cấu trúc và ngữ nghĩa của truyện ngắn gã khổng lồ ích kỷ

Ngày tải lên : 02/03/2015, 14:25
... grammar model developed by M .A. K Halliday (1994) which takes a functional approach to grammar, analyzing language as a social-semiotic of communicative meaning- making Language and interaction are ... Mood and Theme CHAPTER I: INTRODUCTION Rationale There are many grammatical paradigms and each of them views language from different perspectives And among those, systemic functional grammar is a ... general category meaning and the principal participant functions that are associated with each will be shown in the table below Process type Category meaning Participants Material: „doing‟ Actor,...
  • 137
  • 1.1K
  • 4
A survey of technology thinkers and stakeholders shows they believe the internet will continue to spread in a “flattening” and improving world. There are many, though, who think major problems will accompany technology advances by 2020 doc

A survey of technology thinkers and stakeholders shows they believe the internet will continue to spread in a “flattening” and improving world. There are many, though, who think major problems will accompany technology advances by 2020 doc

Ngày tải lên : 29/03/2014, 19:20
... early 1990s predictions are available in a searchable database online at the site Imagining the Internet: A History and Forecast and they are also the basis for a book by Anderson titled Imagining ... mountains in Afghanistan and the behavior of entrepreneurs in Africa.” Adrian Schofield, head of research for ForgeAhead, an information and communications consulting firm, and a leader with Information ... Coopers; formerly of DARPA “It seems paradoxical that the Internet can be a powerful force for memorializing and evangelizing local languages and cultures and differences and still lead to a great...
  • 115
  • 441
  • 0
Chapter 2Communicating Over the Network Quangkien@gmail.com.OverviewDescribe the structure of a network, including the devices and media that are necessary for successful communications. Explain the function of protocols in network communications. Ex potx

Chapter 2Communicating Over the Network Quangkien@gmail.com.OverviewDescribe the structure of a network, including the devices and media that are necessary for successful communications. Explain the function of protocols in network communications. Ex potx

Ngày tải lên : 01/04/2014, 12:20
... (LAN) Local Area Network (LAN) An individual network usually spans a single geographical area, providing services and applications to people within a common organizational structure, such as a ... of a network, including the devices and media that are necessary for successful communications Explain the function of protocols in network communications Explain the advantages of using a layered ... encapsulations Data Link Header IP Header TCP Header HTTP Header Data Data Link Trailer The receiving host receives the message with multiple decapsulations Data Link Header IP Header TCP Header...
  • 52
  • 550
  • 0
Báo cáo y học: "APOBEC3G induces a hypermutation gradient: purifying selection at multiple steps during HIV-1 replication results in levels of G-to-A mutations that are high in DNA, intermediate in cellular viral RNA, and low in virion RNA" pps

Báo cáo y học: "APOBEC3G induces a hypermutation gradient: purifying selection at multiple steps during HIV-1 replication results in levels of G-to-A mutations that are high in DNA, intermediate in cellular viral RNA, and low in virion RNA" pps

Ngày tải lên : 13/08/2014, 05:21
... Vif was amplified using the forward primer YRHHYmutF, 5'GGAAAGCTAAGGACTGGT TTGCTGCAGCTGCCGCTGAAAGTACTAATCCAAAAATA AG3', and the reverse primer VifR, 5'GGATAAACAGCAGT TGTTGC3' The resulting amplicons ... indicated that purifying selection pressure was operating against genomes that had inactivating mutations in the gag gene The observation that a few of the viral RNA-derived sequences had inactivating ... hypermutation in the proviral DNA, cRNA, and vRNA across each individual infection (YA, YB and YC) for Rounds and was determined Statistical significance was calculated using the t-test assuming equal...
  • 15
  • 320
  • 0
ARE THERE ANY FALLACIES IN THE REASONING

ARE THERE ANY FALLACIES IN THE REASONING

Ngày tải lên : 25/10/2013, 15:20
... and disadvantages of making beer more easily available Joe commits two fallacies in his tiny argument First, he attacks Sandra, rather than addressing Sandra's reasoning Sandra's alleged alcoholism ... conclusion A Questioning Approach to Finding Reasoning Fallacies There are numerous reasoning fallacies And they can be organized in many different ways Many are so common that they have been given formal ... specific about advantages and disadvantages, and by keeping a checklist handy of possible reasoning fallacies Practice Exercises (Jj Critical Question: Are there any fallacies in the reasoning?...
  • 20
  • 341
  • 0
Tài liệu Creating a Class That Participates in an Automatic Transaction ppt

Tài liệu Creating a Class That Participates in an Automatic Transaction ppt

Ngày tải lên : 24/12/2013, 05:15
... automatically in an existing transaction, to start a new transaction, or to not participate in a transaction The following steps prepare a class to participate in an automatic transaction: Derive the class ... transactions that span multiple remote databases and multiple resource managers Objects participating in automatic transactions not need to anticipate how they might be used within a transaction ... transaction A client can perform different tasks with multiple objects, all in the context of a single transaction, without the participating objects being aware of the transaction The main drawback...
  • 5
  • 410
  • 0
Tài liệu Art of Surface Interpolation-Chapter 5:Solving special tasks In the next sections there are examples of interpolation problems, ppt

Tài liệu Art of Surface Interpolation-Chapter 5:Solving special tasks In the next sections there are examples of interpolation problems, ppt

Ngày tải lên : 21/01/2014, 07:20
... part of a racing car body was interpreted to obtain results outside the domain determined by points XYZ Fig 5. 2a: Aerodynamic resistance data measured at a small part of a racing car body As the ... 4.2.3.8 Mathematical calculations with grids), where selected binary mathematical operation is performed for all z-values at nodes of grids representing the two surfaces There are two mathematical ... before the avalanche event and AVALAN.DT1 containing the measurement of snow surface after the avalanche event In figure 5. 5a there are two maps of snow surfaces created from the above-mentioned...
  • 17
  • 506
  • 0
Tài liệu There Are Billions of Dollars in Undetected Tax Refund Fraud Resulting From Identity Theft docx

Tài liệu There Are Billions of Dollars in Undetected Tax Refund Fraud Resulting From Identity Theft docx

Ngày tải lên : 18/02/2014, 04:20
... Files that also includes data from the SSA Operation Mass Mailing Database The Operation Mass Mailing database is a database of all tax returns identified as Operation Mass Mail by the Accounts Management ... September 30 Individual Master File An IRS database that maintains transactions or records of individual tax accounts Individual Returns Transaction File An IRS database containing transcribed tax returns ... for individuals that includes most forms and schedules Information Returns Master File An IRS database that contains third-party information documents for taxpayers, such as Forms W-2, Wage and...
  • 40
  • 322
  • 0
Báo cáo khoa học: Organizational constraints on Ste12 cis-elements for a pheromone response in Saccharomyces cerevisiae docx

Báo cáo khoa học: Organizational constraints on Ste12 cis-elements for a pheromone response in Saccharomyces cerevisiae docx

Ngày tải lên : 06/03/2014, 22:21
... et al Table RCS of mutant PREs for binding of wild-type Ste12 to a PRE consensus (ATGAAACA) in vitro FUS1 PREa Sequence RCSb II IV ATGAAACA tTGAAACA AaGAAACA ATaAAACA ATcAAACA ATtAAACA ATGcAACA ... results indicate that there must be structural constraints on Ste12 that allow binding to closely-spaced PREs in several different configurations Additionally, the fact that head-to-head and tail-to-tail ... immediately for DNA binding activity Oligonucleotides used for EMSA are detailed in Table S1, and were annealed and labeled using Klenow (New England Biolabs, Beverly, MA, USA) with [32P]adATP and...
  • 14
  • 428
  • 0
Báo cáo khoa học: Molecular and functional characterization of a novel splice variant of ANKHD1 that lacks the KH domain and its role in cell survival and apoptosis docx

Báo cáo khoa học: Molecular and functional characterization of a novel splice variant of ANKHD1 that lacks the KH domain and its role in cell survival and apoptosis docx

Ngày tải lên : 07/03/2014, 21:20
... (Forward) TAAGCTACTACGTAAAGAATATATC (Reverse) GATAAGGTACCTGCACTGACACGGATGAAAGC (Forward) CATATATTCTTTACGTAGTAGCTTA (Reverse) FEBS Journal 272 (2005) 4091–4102 ª 2005 FEBS 4099 Molecular characterization ... 5¢-GATAAGGTACCTGCACTGACACGGATG AAAGC-3¢ and reverse 5¢-CTAGACTCGAGCCTAAT TTATATTTGCTCCTTGTGC-3¢ b-Actin primers were designed as follows: forward 5¢-CTACAATGAGCTGCG TGT-3¢ and reverse 5¢-AAGGAAGGCTGGAAGAGT-3¢ ... Molecular characterization of ANKHD1 splice variant studies blast searches of VBARP revealed that this protein has homology to human ankyrin repeat and KH domain containing 1(ANKHD1) variants, and...
  • 12
  • 561
  • 0
Livestock and Climate Change What if the key actors in climate change are…cows, pigs, and chickens? docx

Livestock and Climate Change What if the key actors in climate change are…cows, pigs, and chickens? docx

Ngày tải lên : 08/03/2014, 09:20
... not like meat and dairy analogs, protein-rich legumes and grains are readily available alternatives Another option might be artificial meat cultivated in laboratories from cells originating from ... 100 ratio suggests much room for growth in sales of meat and dairy analogs Meat and dairy analogs are already sold throughout the developing world, and as in the United States sales have increased ... children are being increasingly educated on climate change in school, and are searching for activities that allow them to experiment with what they have learned Yet they are major targets when...
  • 10
  • 545
  • 0
Báo cáo Y học: A Ca2+/CaM-dependent kinase from pea is stress regulated and in vitro phosphorylates a protein that binds to AtCaM5 promoter ppt

Báo cáo Y học: A Ca2+/CaM-dependent kinase from pea is stress regulated and in vitro phosphorylates a protein that binds to AtCaM5 promoter ppt

Ngày tải lên : 18/03/2014, 01:20
... 5¢-AAACCAGCCATGAATGAAAT-3¢) and with actin primers (forward primer: 5¢-GTTGGGAT GAACCAGAAGGA-3¢; reverse primer: 5¢-GAACCA CCGATCCAGACACT-3¢) as a control Reactions with no DNA added served as a ... promoter fragment The sequences of the oligonucleotides used for these experiments are: Oligo I, 5¢-CAAGGACGTTCGATGCA CTTCCAAAAAACATATAAT-3¢; Oligo II, 5¢-CAAT GTAGTATTAAAAAGTAGTAGTTAAAAGC-3¢; Oligo ... PsCCaMK suggesting that this kinase is not a general stress-regulated kinase but may specifically be involved in a signaling pathway associated with salinity and low temperature stress As both NaCl...
  • 12
  • 365
  • 0
English gerunds and present participles – how to use in building a sentence

English gerunds and present participles – how to use in building a sentence

Ngày tải lên : 18/03/2014, 17:17
... devide “dancing” into two “-dance” and “-ing” These forms have no partical resemblance to any other form and, therefore, are morphemes We can treat “singing” and “dancing” by saying that each has two ... “rather than” deservers mention as the only subordinator introducing a bare infinitive clause, in a separate tone and formal way, an -ing participle For instances: - I always prefer starting early, ... be related to those for adverbial in general and for prepositional phrases Adverbial clause, like abverbials in general, are capable of occurring in a final, initial or medial position within the...
  • 83
  • 753
  • 2
Báo cáo khoa học: "What’s There to Talk About? A Multi-Modal Model of Referring Behavior in the Presence of Shared Visual Information" potx

Báo cáo khoa học: "What’s There to Talk About? A Multi-Modal Model of Referring Behavior in the Presence of Shared Visual Information" potx

Ngày tải lên : 24/03/2014, 03:20
... human referring behavior in the presence of shared visual information They suggest that shared visual information of the task objects and surrounding workspace can significantly impact collaborative ... behavior in the presence of visual information could enable agents to emulate many elements of more natural and realistic human conversational behavior A computational model may also make valuable ... We also extend these models to a new task domain that can elaborate on referential patterns in the presence of various forms of shared visual information Finally, we make use of a corpus gathered...
  • 8
  • 567
  • 0
A pathway that links reproductive status to lifespan in Caenorhabditis elegans pptx

A pathway that links reproductive status to lifespan in Caenorhabditis elegans pptx

Ngày tải lên : 28/03/2014, 16:20
... interesting to ask whether this same reproductive signaling pathway, or a molecular variant, might in uence lifespan in higher animals There are several intriguing parallels with Drosophila that ... mutants (which can not make dafachronic acid) restores full DAF-16 nuclear localization and lifespan extension.17 This finding suggests that the DAF-12 signaling pathway plays a role in mediating ... story has begun to emerge (and is summarized in Figs and 3) First, the pathway that triggers DAF-16/FOXO nuclear localization is at least partially distinct from the pathway that localizes DAF-16...
  • 7
  • 446
  • 0
Báo cáo khoa học: A novel glycogen-targeting subunit of protein phosphatase 1 that is regulated by insulin and shows differential tissue distribution in humans and rodents pdf

Báo cáo khoa học: A novel glycogen-targeting subunit of protein phosphatase 1 that is regulated by insulin and shows differential tissue distribution in humans and rodents pdf

Ngày tải lên : 30/03/2014, 16:20
... gacgaggcgcctgcggccgacggcggaaaacaccaaaggcacccgggggcggggcgacccgatgtggcggggaggagtag 920 I H F I * 279 921 gagagaccaggattggcgggagcggtccaagggagtc 957 Fig (A) Diagram of human PPP1R3E mRNA compared with PPP1R3E ... TRKRVRFAD APRRVLFAD CKKRVQFAD Glycogen binding domain MOUSE R3E 178 ARVLDLAYEKRVSVRWSADGWRSLRESPASYAGPAPSPPRADRFAFRLPAPPVGGTLLF RAT R3E 178 ARVLDLAYEKRVSVRWSADGWRSLRESPASYAGPAPAPPRADRFAFRLPAPPVGGALLF ... RGRRARSAPAGGGGARAPRSRSPDTRKRVRFADALGLELAVVRRFRPGELPRVPRHVQI MOUSE R3E 119 QLQRDALRHFAPCPPRARGLQEARVALEPALEPGFAARLQAQRICLERADAGPLGVAGS RAT R3E 119 QLQRDALRHFAPCPPRTRGLQDARIALEPALEPGFAARLQAQRICLERADAGPLGVAGS HUMAN R3E...
  • 12
  • 381
  • 0

Xem thêm