i domain and i like domain

Tài liệu Báo cáo khoa học: DNA modification with cisplatin affects sequence-specific DNA binding of p53 and p73 proteins in a target site-dependent manner pptx

Tài liệu Báo cáo khoa học: DNA modification with cisplatin affects sequence-specific DNA binding of p53 and p73 proteins in a target site-dependent manner pptx

... (genomic) DNA [26] Provided that the cisplatin inhibitory effect on p53 sequence-specific DNA binding is linked primarily to the IACs formed within the target sites, the susceptibility of different ... inverting the TA pair at position Inhibition of p53(1–363) binding to this site due to its treatment with cisplatin did not exceed the effect observed with the p21a site (also involving a single ... contribute to its high sensitivity to the cisplatin treatment We tested this possibility using another p53DBS containing a single AG doublet (and no other reactive motif) derived from PGM4 by inverting...

Ngày tải lên: 19/02/2014, 05:20

14 598 0
Tài liệu Báo cáo khoa học: Different mechanisms for cellular internalization of the HIV-1 Tat-derived cell penetrating peptide and recombinant proteins fused to Tat docx

Tài liệu Báo cáo khoa học: Different mechanisms for cellular internalization of the HIV-1 Tat-derived cell penetrating peptide and recombinant proteins fused to Tat docx

... unlikely The number of arginine residues within the Tat peptide appeared to be the main determinant for maintaining a high translocating activity as previously shown by alanine-arginine substitution ... intensity could be slightly variable among that population In addition to these genetic ®ndings, we treated cells with heparinase III prior to their incubation with the different Tat derived molecules ... to b-galactosidase was even observed in vivo in various tissues including the brain after intraperitoneal injection into the mouse [6] While comparative studies are still lacking, it can be speculated...

Ngày tải lên: 21/02/2014, 03:20

8 485 0
Báo cáo khoa học: Dynamin-related proteins and Pex11 proteins in peroxisome division and proliferation doc

Báo cáo khoa học: Dynamin-related proteins and Pex11 proteins in peroxisome division and proliferation doc

... dynamin for division DRPs in the division of peroxisomes The mammalian DRP, DLP1, partially localizes to peroxisomes and is involved in peroxisome fission Its peroxisomal localization is more readily ... for Penicillium chrysogenum, where PEX11 overexpression likewise leads to the proliferation of microbodies and an increase in penicillin production, which is not accompanied by a significant increase ... (2003) Dynamin -like protein is involved in peroxisomal fission J Biol Chem 278, 8597–8605 Li X & Gould SJ (2003) The dynamin -like GTPase DLP1 is essential for peroxisome division and is recruited to...

Ngày tải lên: 07/03/2014, 21:20

13 372 0
Báo cáo khoa học: DNA mediated disassembly of hRad51 and hRad52 proteins and recruitment of hRad51 to ssDNA by hRad52 pot

Báo cáo khoa học: DNA mediated disassembly of hRad51 and hRad52 proteins and recruitment of hRad51 to ssDNA by hRad52 pot

... respectively, Fig 1D) This effect might arise either due to steric hindrance imparted by ssDNA binding or to changes in protein configuration ⁄ conformation following ssDNA binding or a combination ... associated with the rise of a signal at high molecular weight region in the gel (at asterisk position in lanes and 10) This was observed both with and without ATP In parallel, we studied protein ... 2–4, respectively, Fig 1A) However, the signals associated with protein–DNA complexes (position indicated by asterisk) appear to diminish and that of higher oligomeric forms that enter into the...

Ngày tải lên: 16/03/2014, 14:20

9 378 0
Báo cáo khoa học: Differential expression of liver and kidney proteins in a mouse model for primary hyperoxaluria type I pdf

Báo cáo khoa học: Differential expression of liver and kidney proteins in a mouse model for primary hyperoxaluria type I pdf

... 13278579 16740777 gi: gi: gi: gi: gi: gi: gi: gi: gi: 14789706 387083 12850132 13542872 12805529 15488762 15488685 109571 18043201 gi: 81894107 gi: gi: gi: gi: gi: gi: gi: gi: gi: gi: NCBI no 10 10 10 ... metabolism The reduction in d-amino acid oxidase expression in the kidney proteome is interesting, in view of the contribution of this enzyme to glyoxylate production from glycine Thus, it could ... W (1988) Improved staining of proteins in polyacrylamide gels including isoelectric focusing gels with clear background at nanogram sensitivity using Coomassie Brilliant Blue G-250 and R-250...

Ngày tải lên: 23/03/2014, 03:20

9 482 0
Báo cáo khoa học: Biogenesis of peroxisomes Topogenesis of the peroxisomal membrane and matrix proteins ppt

Báo cáo khoa học: Biogenesis of peroxisomes Topogenesis of the peroxisomal membrane and matrix proteins ppt

... E3–ubiquitin protein ligases in ubiquitin and ubiquitin -like conjugations [61], Pex2p, Pex10p and Pex12p might be involved in the ubiquitination of the import receptor Pex5p recycling to the cytosol has ... phosphatidylserine is imported into mitochondria via a mitochondria-associated membrane and that the majority of mitochondrial phosphatidylethanolamine is derived from decarboxylation of phosphatidylserine ... peroxisomal targeting signal, whereas its C-terminus binds Pex19p at regions distinct from the PMP binding site The interaction of Pex19p with Pex3p is essential for peroxisomal membrane protein import,...

Ngày tải lên: 23/03/2014, 13:20

11 556 0
applications of chimeric genes and hybrid proteins, part a

applications of chimeric genes and hybrid proteins, part a

... fusion with high activity Differences between strains with 300 Miller units of /3-galactosidase activity and those with wild-type (1000 Miller units) activity are indistinguishable on minimal ... low/3-galactosidase activity can grow on minimal lactose media By adding TPEG to minimal media, the minimum inhibitory concentration sufficient to prevent growth of a particular fusion-containing strain ... understanding of microbial biology This is particularly true in the study of microbial pathogenesis, where investigators have focused their efforts in identifying and monitoring the change in expression...

Ngày tải lên: 10/04/2014, 11:02

614 282 0
applications of chimeric genes and hybrid proteins, part b

applications of chimeric genes and hybrid proteins, part b

... cannot be distinguished with conventional antibodies For example, epitope tagging permits discrimination of individual members of closely related protein families or the identification of in vitro-mutagenized ... TRAFFICKING ANALYSIS, LINEAGE TRACING 121 while introducing artificial restriction sites at the ends of the insert If PCR is employed, use conditions to minimize the introduction of mutations; ... recognition by the corresponding antibody This is especially the case in experiments in which the protein must be recognized in its native conformation, such as immunostaining or immunoprecipitation...

Ngày tải lên: 10/04/2014, 11:02

696 394 0
báo cáo hóa học:" Proteomic characterization of HIV-modulated membrane receptors, kinases and signaling proteins involved in novel angiogenic pathways" ppt

báo cáo hóa học:" Proteomic characterization of HIV-modulated membrane receptors, kinases and signaling proteins involved in novel angiogenic pathways" ppt

... Adhesion: Anti-angiogenic G-Protein Coupled Receptors Brain-specific angiogenesis inhibitor (BAI1) O14514 Brain-specific angiogenesis inhibitor (BAI3) O60242 Adhesion, Differentiation & Cell Migration: ... Kim JK, Bae CS, Kim KK: Expression of brain-specific angiogenesis inhibitor (BAI3) in normal brain and implications for BAI3 in ischemia-induced brain angiogenesis and malignant glioma FEBS Lett ... "Anti-angiogenic" G-Protein Coupled Receptors Brain-Specific Angiogenesis Inhibitors and Two cellular proteins, the brain-specific angiogenesis inhibitors -1 and -3 (BAI1 and BAI3 respectively)...

Ngày tải lên: 18/06/2014, 15:20

24 507 0
báo cáo hóa học:" Correlation between expression of p53, p21/WAF1, and MDM2 proteins and their prognostic significance in primary hepatocellular carcinoma" docx

báo cáo hóa học:" Correlation between expression of p53, p21/WAF1, and MDM2 proteins and their prognostic significance in primary hepatocellular carcinoma" docx

... liver tissues is significantly higher than that in HCC tissues, indicating that its expression might represent a form of cyclin dependent kinase (CDK) inhibitor dysfunction involved in tumorigenesis ... WAF1/CIP1 gene and its expression is directly induced by the wild-type p53 protein [4] This protein binds to a variety of cyclin-dependent kinases and inhibits their activity, regulates DNA repair, ... develops in patients with chronic liver diseases, and its etiopathogenesis includes viral infection (hepatitis B and C), alcohol, and aflatoxin B1 consumption The majority of HCC patients have associated...

Ngày tải lên: 18/06/2014, 15:20

8 611 0
báo cáo hóa học: " Leader (L) and L* proteins of Theiler''''s murine encephalomyelitis virus (TMEV) and their regulation of the virus'''' biological activities" docx

báo cáo hóa học: " Leader (L) and L* proteins of Theiler''''s murine encephalomyelitis virus (TMEV) and their regulation of the virus'''' biological activities" docx

... other functions of picornaviruses FMDV L is involved in inhibiting phosphorylation of eukaryotic initiation factor by double-strand RNAdependent protein kinase [33] L of cardioviruses inhibits the ... properties and biological activities The TMEV virion is an icosahedron approximately 28 nm in diameter with no lipid-bilayer envelope A singlestranded RNA is packaged in the shell that consists ... IFN α/β [37] The zinc-binding motif within L directly binds zinc ions and is a key factor in the inhibition of IFN α/β expression [36,37,40,41] The importance of IFN α/β in the animal's host cell...

Ngày tải lên: 19/06/2014, 22:20

8 447 0
Báo cáo hóa học: " Respiratory syncytial virus (RSV) attachment and nonstructural proteins modify the type I interferon response associated with suppressor of cytokine signaling (SOCS) proteins and IFN-stimulated gene-15 (ISG15)" potx

Báo cáo hóa học: " Respiratory syncytial virus (RSV) attachment and nonstructural proteins modify the type I interferon response associated with suppressor of cytokine signaling (SOCS) proteins and IFN-stimulated gene-15 (ISG15)" potx

... expression inhibits IFNβ and ISG15 protein expression is consistent with evidence suggesting that IFNβ and ISG15 are induced in parallel as a primary response to infection [1,38,41,42], and that this ... proteins mediate IFN antagonism in part by affecting SOCS1 negative regulation of type I IFN activity [7,24] Similar to the 24 h pi finding, at 48 h pi ΔG virus infected cells expressed significantly ... type I IFN during RSV infection, but may have an ancillary role to facilitate virus replication RSVΔG virus infection mediates enhanced IFNβ secretion Intracellular type I IFN expression in RSV and...

Ngày tải lên: 20/06/2014, 01:20

11 435 0
Báo cáo y học: "Diagnostic value and clinical laboratory associations of antibodies against recombinant ribosomal P0, P1 and P2 proteins and their native heterocomplex in a Caucasian cohort with systemic lupus erythematosus" pot

Báo cáo y học: "Diagnostic value and clinical laboratory associations of antibodies against recombinant ribosomal P0, P1 and P2 proteins and their native heterocomplex in a Caucasian cohort with systemic lupus erythematosus" pot

... aRibPs provide additional diagnostic benefit in direct comparison to anti-dsDNA and anti-Sm antibodies Exactly 10% of sera negative in the anti-Sm and antidsDNA ELISAs were positive for aRibPR0 ... H+ RibN RibRP0+ RibRP1+ RibRP2+ SLE-DIAGNOSIS Figure Additional diagnostic benefit of antiribosomal P protein antibodies in lupus patients Both flow charts aim to demonstrate the additional diagnostic ... Caponi L, Franceschini F, Zampieri S, Quinzanini M, Bendo R, Bombardieri S, Gambari PF, Doria A: Diagnostic tests for antiribosomal p protein antibodies: a comparative evaluation of immunoblotting...

Ngày tải lên: 12/08/2014, 15:22

11 415 0
Báo cáo y học: "Rev and Rex proteins of human complex retroviruses function with the MMTV Rem-responsive element" doc

Báo cáo y học: "Rev and Rex proteins of human complex retroviruses function with the MMTV Rem-responsive element" doc

... result in interactions with HERV-Ks or the generation of recombinant infectious viruses Prior experiments indicate that HIV Rev and HTLV Rex can activate expression from reporter plasmids containing ... visible in this portion of the gel (upper panel) Similar levels of Rem, Rex1 and Rex2 fusion proteins are observed using the GFP-specific antibody Incubation with an actin-specific antibody revealed ... assay, which is difficult to achieve using RNA fractionation experiments and Northern blotting Rev/RRE interactions also have been shown to affect Gag trafficking and HIV assembly, and it has been...

Ngày tải lên: 13/08/2014, 05:21

13 246 0
Báo cáo y học: " Determination of the relative amounts of Gag and Pol proteins in foamy virus particles" doc

Báo cáo y học: " Determination of the relative amounts of Gag and Pol proteins in foamy virus particles" doc

... gel Relation4 the intensities of the bands in the lanes with recombinant PFV proteins shown in Fig and amounts of protein Relation of the intensities of the bands in the lanes with recombinant PFV ... fractions and were the main gradient fractions in which viral Gag and Pol proteins were detected by immunoblotting Fraction was also the main fraction of viral infectivity as shown in Fig 3B A ... protein is abundant in cells lytically infected with FV We first estimated the amount of Pol proteins present in FV infected cells In addition, we determined the sensitivity of the MABs in detecting...

Ngày tải lên: 13/08/2014, 09:21

7 318 0
Báo cáo y học: "Phylogenetic and structural analysis of centromeric DNA and kinetochore proteins" doc

Báo cáo y học: "Phylogenetic and structural analysis of centromeric DNA and kinetochore proteins" doc

... 10 Identification of a minimal kinetochore in E cuniculi Identification of a minimal kinetochore in E cuniculi (a) HMM described in Figure 1a, b failed to find a CDEI-II-III structure in the genome ... distinct biochemistry, point CENs with structures other than CDEI-II-III might exist Evolution of kinetochore proteins MFTLEHIRPMDINLGDIFTTTGRRQAQKEDRYTKTTIGIHTSVLASIRLMTSSRS Figure 10 Identification ... kinesins present at kinetochores in S cerevisiae are Kip3 (Kinesin-8), Cin8 (Kinesin-5), Kip1 (Kinesin-5) and Kar3 (Kinesin-14), while in S pombe they are Klp5 (Kinesin-8), Klp6 (Kinesin-8) and...

Ngày tải lên: 14/08/2014, 16:21

21 384 0
Studies on interactions between HCRSV coat protein and host proteins from kenaf

Studies on interactions between HCRSV coat protein and host proteins from kenaf

... affinity purification and are very similar to immuno-precipitation except that a bait protein is used instead of an antibody This approach is a common variation of immunoprecipitation and immunoelectrophoresis ... protein, a putative chaperon P13.9, a C2 domain- containing protein, a ricin domain- containing protein and putative alpha-D-xylosidase like protein The interaction of CP and SO was confirmed by in ... activating domain Aux/IAA auxin/indole acetic acid AOX alternative oxidase amiRNA artificial microRNA BD binding domain BiFC bimolecular fluorescence complementation bp base pair(s) BSA bovine...

Ngày tải lên: 11/09/2015, 10:17

190 380 0
X ray crystallographic study of yeast dcp1 and dcp2 proteins insights into the mechanism and regulation of eukaryotic mRNA decapping

X ray crystallographic study of yeast dcp1 and dcp2 proteins insights into the mechanism and regulation of eukaryotic mRNA decapping

... spin Miniprep Kit QIAGEN QIAquick Gel Extraction Kit QIAGEN QIAquick PCR purification Kit QIAGEN Coomassie Protein Assay Kit PIERCE 37 Site-Directed Mutagenesis Kit QIAGEN AmpliScribe High Yield ... homodimer in solution and the dimeric complex is the functional unit Each monomer is composed of two distinct domains: the N-terminal domains dimerize in a domain- swap mode and the C-terminal domains ... is not essential for mRNA decapping in vivo, but it can stimulate the decapping efficiency It contains a Sm -like domain in the N-terminus and two conserved but functionally unidentified domains...

Ngày tải lên: 14/09/2015, 12:28

125 343 0
Crystallization trials of refolded breast tumor kinase (BRK) and peroxisome proteins

Crystallization trials of refolded breast tumor kinase (BRK) and peroxisome proteins

... kinase domain (Sichery and Kuriyan, 1997) The SH2 domain, on the other hand, is essential in controlling interactions It recognizes and binds to phosphorylated tyrosine residues, with the specificity ... purification by FPLC and lane shows the higher yield of denatured protein after purification by an affinity column which indicates the loss of protein during rapid dilution and dialysis 4.1.6 Circular ... and infantile Refsum disease (IRD) The clinical pictures of these disorders show similarities, but an important difference is a difference in severity, the clinical course being most severe in...

Ngày tải lên: 04/10/2015, 10:24

74 255 0
w