equations with kernel of the form k ••••••••••••••• • •••••••†•••••

... in the central cylinder of the root, but not in the lower parts of the hypocotyl (a) Rosette leaves were stained in the vascular tissue of the leaf blade, whereas the petiole and older parts of ... stained In the flower, we detected GUS expression exclusively in the pollen Siliques were stained at the base and at the tip, with overall very weak staining of the fused carpels In the root, the central ... around 150 amino acids forming eight b-sheets [23] The motif was noted on the basis of homology with the C-terminal region of meprins A and B and the TRAF-C domain, and, like the BTB domain, facilitates...

Ngày tải lên: 18/02/2014, 06:20

... evidently, the only true motive for benevolent actions Then they are a pleasure: then the divergence of the impulse of duty from the impulse of inclination is done away; and I believe the love of God ... through all The shining of the fire and the shading of the cloud are yet in the ordering of the Captain of Salvation 32 20th Exceeding poor; and yet I rejoice in what I trust is somewhat of the poverty ... discovery of the discrepancy between the two, does not lead us to lower the one rather than seek to elevate the other I have a strong belief of the importance of self-scrutiny and honesty with one's...

Ngày tải lên: 16/03/2014, 01:20

... progressive shrinking and weakness of the skeletal muscle such as to cause varying degrees of disability The individual muscle diseases differ in their age of onset, their rate of progression and their ... of disability access legislation in the US and the higher proportion of spacious urban living in the US as compared with the higher proportion of crowded city living in the UK The influence of ... correlation with the difficulty of the question.[10] We calculated fit of the observed data to the Rasch model and compared responses to questions in UK and US populations In the course of the original...

Ngày tải lên: 20/06/2014, 15:20

... Remark 1.5 From Remark 1.4, we know that if 1.16 holds true, then we have u Lq ≤C u r/q Lr u 1−r/q , ˙0 B∞,∞ ≤ r < q < ∞ 1.21 Proof of Theorem 1.2 This section is devoted to the proof of Theorem ... regularity of weak solutions of the Navier-Stokes system,” Journal of Differential Equations, vol 62, no 2, pp 186–212, 1986 M Struwe, “On partial regularity results for the Navier-Stokes equations, ” ... Applied Mathematics, vol 41, no 4, pp 437–458, 1988 6 Journal of Inequalities and Applications H Sohr and W von Wahl, “On the regularity of the pressure of weak solutions of Navier-Stokes equations, ”...

Ngày tải lên: 22/06/2014, 02:20

... denote the component (closed connected maximal subset with respect to the inclusion) of J to which (0,0) belongs Then if C ∩ {0} × E = (0,0) , (3.1) then C is unbounded in R+ × E Proof of Theorem ... solution u to the problem (P)0 Acknowledgments The first author would like to thank the hospitality of Departamento de Matem´ ticas, a Universidad de Tarapac´ He also wants to thank Professors Heriberto ... τn n (2.31) Arguing as in the proof of Claim in the above case xn ∈ ∂Ω0 for all n, we may assume that δn Sn θ ≥ d0 = d0 (p,α,β,N,c0 ) > Therefore, the limit w of the sequence wn satisfies −Δm...

Ngày tải lên: 22/06/2014, 19:20

... rule out, the lack of demonstrable endometriosis associated with the patient’s current tumor makes this hypothesis unlikely [16] Several theories have emerged in the attempt to explain the biphasic ... Immunohistochemical stain with Vimentin shows areas with strong immunoreactivity of the epithelial and mesenchymal cells (× 400) Page of examination of the uterus and adnexae Furthermore, absence of calretinin ... masses with areas of necrosis and hemorrhage The uterus and the Fallopian tubes were unremarkable The right and the left ovary were of normal dimensions Numerous sections were taken from the tumor...

Ngày tải lên: 09/08/2014, 01:24

... cancer with an aspergilloma-like shadow Lung Cancer 1999, 26(3):195-8 Tomioka H, Iwasaki H, Okumura N, et al: Undiagnosed lung cancer complicated by intracavitary aspergillosis Nihon Kokyuki Gakkai ... YO acquired the data LC performed the histopathological evaluation and interpretation of the data KZ performed the histopathological evaluation and interpretation of the data AA gave final approval ... agent and the image does not change or continues to increase, when the fungus ball-like shadow is fixed to a thick and irregular wall of the cavity and its position is not altered with the patient’s...

Ngày tải lên: 09/08/2014, 01:24

... Role of sonography in the diagnosis of gallbladder perforation J Clin Ultrasound 2002, 30:270-4 10 Ishihara S, Miyakawa S, Takada T, Takasaki K, Nimura Y, Tanaka M, Miyazaki M, Nagakawa T, Kayahara ... in about 10% of patients with a pT1 carcinoma of the papilla Therefore, Kausch-Whipple procedure or PPPD with lymph node dissection is the first choice of treatment even in patients with localized ... Vater: KauschWhipple procedure with lymph node dissection in cancer of the papilla of Vater J Hepatobiliary Pancreat Surg 2004, 11:232-8 13 Kobayashi A, Konishi M, Nakagohri T, Takahashi S, Kinoshita...

Ngày tải lên: 09/08/2014, 03:21

... Nishikawa S, Yoshinaga K, Kobayashi S, Nishi K, Nishikawa S: Requirment of c-kit for development of intestinal pacemaker system Development 1992, 116:369-375 Takano M, Saito K, Kita T, Furuya K, ... c-kit, but if they do, the staining is usually focal, with fewer than 5% of cells been positive [9,20,12] The final diagnosis of our patient was established based on the intestinal origin of the ... 2004, 31:73-8 Hirota S, Isozaki K, Moriyama Y, Hashimoto K, Nishida T, Ishiguro S, Kawano K, Hanada M, Kurata A, Takeda M, Muhammad TG: Gain-offunction mutations of c-kit in human gastrointestinal...

Ngày tải lên: 09/08/2014, 03:22

... nmol N02-mg- measured in vivo in the leaves of young nitrogen-deficient R pseudoacacia; its role is unknown, but its decrease, concomitant with the advent of the N activity, indicates a relationship ... expanded, the NR activity decreased in the previous leaf and the highest enzyme activity was found again in the new leaf (Fig 2) When the nitrate supply was withdrawn, the enzyme activity recovered its ... After 72 h of induction, the highest NR activity was found in the apical fully expanded leaf and corresponded with the highest nitrate content (Table I) When a new leaf expanded, the NR activity...

Ngày tải lên: 09/08/2014, 04:20

... necessary, they were defined as a part of the CTV Inverse treatment-planning was performed using the KonRad software developed at the German Cancer Research Center (dkfz), which is connected to the ... the median of the target volume, meaning 50% of the target volume receives 100% of the dose The median target volume was chosen for dose prescription since is represents the majority of the defined ... depicted in Fig The main goal was optimal sparing of the optic structures as well as the brain stem, without compromising the dose conformality to the CTV and PTV A summary of the DVHdata can...

Ngày tải lên: 09/08/2014, 10:21

... where k  (4   ) M The harmonic spectrum Ea  f  of the error current is the convolution of the spectra of the product terms e1  t  and e2  t  in (14) Therefore, k k   Ea ( f )  (8  k ... spectrum of the error current is derived by calculating the Fourier transform of the complex envelope of frequency modulated signal Results in the literature derived the instantaneous frequency of the ... current generation As the PLL synchronizes the reference current with the terminal voltage, the propagation of harmonic currents might affect the detection of the zeros-crossings of the terminal voltage...

Ngày tải lên: 09/08/2014, 16:21

... K/ k 12 ± 2.4 + w + k /k 17 ± 3.2 + Periods (weeks) and genotypes w w + + + + K/ k k /k K /k k+ /k+ 6 6 31 ± 9.6 23 ± 6.6 33.8 ± 10.2 43.8 ± 9.9 K/ k – – + 10 w k+ /k+ – – % of feathers 6 10.24 ± 1.24 ... to whom the body and feathers of the chick at weeks of age are in competition for arginin and cystein, of which the requirement is more important during the synthesis of feathers Feathering ... that the K/ k+ cockerels had slightly lower food efficiency than the k+ /k+ cockerels at weeks of age, the difference being in the reverse direction at 10 weeks Our study also showed that the two...

Ngày tải lên: 09/08/2014, 18:21

... pertaining to the spine, such as a disk herniation, fracture, or foraminal or central spinal stenosis; Page of • prompt response to anesthetic infiltration of key tender points in the region of the upper ... oriented skin incision across the shoulder While the patient is still anesthetized generally thickened fascia, including septae between bundles of the muscle, are excised from the painful area of the ... skin markings corresponding to the previously identified key tender points The dissection is continued anteriorly along the leading edge of the trapezius until the SAN was identified In most of...

Ngày tải lên: 10/08/2014, 10:20

... Osteoarthritis of the talonavicular joint with pseudarthrosis of the navicular bone: a case report Noriyuki Kanzaki1*, Takayuki Nishiyama1, Takaaki Fujishiro1, Shinya Hayashi1, Yoshiyuki Takakura2, Yoshinori ... Yoshinori Takakura2, Masahiro Kurosaka1 Department of Orthopedic Surgery, Kobe University Graduate School of Medicine, 7-5-1, Kusunoki-Cho, Tyuo-Ku, Kobe, 650-0017, Japan; 2Department of Orthopedic ... Surgery, Takakura Orthopedic and Sports Clinic, 5-4-21, Tokui-Cho, Nada-Ku, Kobe, 657-0033, Japan *Corresponding author NK: kanzaki@med.kobe-u.ac.jp TN: nishiyam@med.kobe-u.ac.jp TF: taka2446@yg8.so-net.ne.jp...

Ngày tải lên: 10/08/2014, 22:20

... Although they were once considered different stages of the same disease, they are now known to represent separate entities [2] The former is a localized hyperplasia of atypical endothelial cells with ... KD on histopathological grounds The presence of vascular hyperplasia with plump endothelial cells protruding into the lumen is the most important discriminator in establishing the diagnosis of ... from the Oculoplastics departments and were the attending physician responsible of providing all the clinical information All authors participated in the design of the manuscript BF, AAlk and...

Ngày tải lên: 11/08/2014, 10:22

... With the assistance of this “joystick” Kirschner wire, the humeral shaft was manipulated easily and closed reduction and percutaneous fixation with three Kirschner wires were performed Once the ... roentgenogram of the left elbow We removed the Kirschner wires from both the elbow and the shoulder and the splint as an outpatient procedure after weeks of radiographic healing and a range of motion ... the combination of ipsilateral fracture of the elbow and forearm Gausepohl et al [7] reported a case with fracture dislocation of the elbow combined with unstable distal forearm fracture of the...

Ngày tải lên: 11/08/2014, 14:21

... appointments Furthermore, SL was involved in the active followup and workup of the patient SL wrote the paper with the assistance of GF RAM reviewed and edited the initial manuscript DJH performed the initial ... organised the primary management plan of the patient He supervised the writing and editing of the paper All the authors have read and approved the final version of the manuscript Consent Written informed ... radical mastectomy with either SNB or axillary node clearance (ANC) [2,3,6] Despite the lack of firm evidence about the safety of SNB, increasingly there is an acceptance of the technique and...

Ngày tải lên: 11/08/2014, 23:21

... obtained from the ethics committee of the University of Bonn All patients consented to partaking in the study The study adhered to the tenets of the declaration of Helsinki Quality of life outcome ... multidimensionality in the scale Although the raw variance explained by the PCA of the residuals was adequate (64.2%), the unexplained variance in the first contrast of the residuals was 3.9, suggesting the existence ... Infrastructure Support from the Victorian Government RPF and EF had full access to all the data in the study and take responsibility for the integrity of the data and the accuracy of the data analysis...

Ngày tải lên: 11/08/2014, 23:22

... Antho_MYBsVRKGXWTXEEDXLLRXCIXXXGEGKWXXVXXXAGLXRCRKSCRXRWLNYLKPXIKRGXFXXDEVDLIIRLHKLLGNRWSLIAXRLPGRTANXVKNYWXXXXXXXX Other_MYBsLKKGPWTPEEDEKLISYIXXHGEGNWRSLPKKAGLXRCGKSCRLRWINYLRPDIKRGNFTEEEEELIIXLHALLGNRWSXIARHLPGRTDNEIKNYWNTHLKKKL R V ... Page of 17 A 10 20 30 40 50 60 70 80 90 100 Rosa_MYB10VRKGAWTREEDXLLRQXIEXXGEGKWXXVXXXAGLXRCRKSCRXRWLNYLKPNIKRGDFXEDEVDLIIRLHKLLGNRWSLIAXRLPGRTANXVKNYWNTXXXXXX Antho_MYBsVRKGXWTXEEDXLLRXCIXXXGEGKWXXVXXXAGLXRCRKSCRXRWLNYLKPXIKRGXFXXDEVDLIIRLHKLLGNRWSLIAXRLPGRTANXVKNYWXXXXXXXX ... Walker AR: Lightinduced expression of a MYB gene regulates anthocyanin biosynthesis in red apples Plant Physiol 2006, 142(3):1216-1232 40 Nakatsuka T, Haruta KS, Pitaksutheepong C, Abe Y, Kakizaki...

Ngày tải lên: 12/08/2014, 03:21