equations of the form y b g dt f

Tài liệu Báo cáo Y học: Puriﬁcation, characterization, immunolocalization and structural analysis of the abundant cytoplasmic b-amylase from Calystegia sepium (hedge bindweed) rhizomes ppt

Ngày tải lên : 22/02/2014, 07:20

... that the distance of 7.89 A between Glu183 (homologous to Glu186 of soybean b- amylase) and Glu381 (homologous to Glu380 of soybean b- amylase) of the C sepium b- amylase, ﬁts the inverting hydrolytic ... in all b- amylases from plants and microorganisms (e .g 97Gly-Gly-Asn-Val-GlyAsp-Ala-Val104 of Calystegia b- amylase and 96Gly-GlyAsn-Val-Gly-Asp-Ile-Val103 of the soybean b- amylase) Docking experiments ... and Cys344) are homologous to those found in soybean b- amylase (Cys82, Cys97, Cys208 and Cys343) On the analogy of the soybean b- amylase, the active site of the C sepium b- amylase most probably...

11
611
0

Báo cáo Y học: Solution structure of the Alzheimer amyloid b-peptide (1–42) in an apolar microenvironment Similarity with a virus fusion domain potx

Ngày tải lên : 08/03/2014, 09:20

... interaction and destabilization is different in the case of Ab, Fig Comparison of the shapes of the lowest energy structure of HA_fd (A) and of the 1–35 region of Ab-(1–42) (B) Residue side chains ... semiconserved in yellow but it is fair to say that the similarity with the fusion domain of a virus is strongly suggestive of membrane disruption The recent observation of a strong synergism between Ab and ... analysis of NOESY spectra evidenced only the presence of sequential, short-range contacts, suggesting the absence of any preferential conformation In the end, we found that stable, mM solutions of...

7
624
0

Báo cáo Y học: Role of conserved residues within helices IV and VIII of the oxaloacetate decarboxylase b subunit in the energy coupling mechanism of the Na+ pump ppt

Ngày tải lên : 08/03/2014, 23:20

... protocol For the PCR fragment encoding the N-terminal part of the b subunit, primers Kpn2Ifor (5¢-GCTTCGGCGGCCTGCTCTCC-3¢) and N373Drev (5¢-AGCCGATCAGCGGATCGATTTTGTG CCGG-3¢) were used For the PCR fragment ... Simultaneously, the Na+ binding ligands are probably rearranged into a geometry, which is less favourable for Na+ binding The binding of Na+ to free OadB (without carboxybiotin bound) with an afﬁnity of 20– ... inhibitory effect of Na+ were ﬁtted to an exponential decay Effect of Na+ on tryptic hydrolysis of the oxaloacetate decarboxylase b subunit Protection from proteolytic digestion of the b subunit...

8
508
0

Báo cáo Y học: Engineering and mechanistic studies of the Arabidopsis FAE1 b-ketoacyl-CoA synthase, FAE1 KCS pot

Ngày tải lên : 24/03/2014, 03:21

... 5¢-GAACGTGTTGGTTCCGC GTGGTAGCGCATGTGATGATCCGTCCTCG-3¢ and an antisense primer 5¢-CACATGCGCTACCACGCGG AACCAACACGTTCCGTGAAGAAGTATC-3¢ were used (underlined sequence encodes for thrombin cleavage ... Solubilization and puriﬁcation of N-terminus His-tagged FAE1 KCS Fig Hydropathy analysis of FAE1 KCS (A) Hydropathy plot of FAE1 KCS indicating the presence of several hydrophobic regions The ... enzyme Taken together, the analysis of the decarboxylation activity and characterization of the mutants of the putative catalytic triad strongly support the hypothesis that the membrane-bound FAE1...

9
457
0

Báo cáo Y học: Substrate selectivity and sensitivity to inhibition by FK506 and cyclosporin A of calcineurin heterodimers composed of the a or b catalytic subunit potx

Ngày tải lên : 24/03/2014, 03:21

... noncompetitively by binding to the CnB-binding helix, CnB, and one side of the substrate-binding cleft of the catalytic site to alter the active-site geometry [16,17,20,22] As the mechanism of inhibition of ... CaM-binding domain and the CnBbinding helix and increases the afﬁnity of the CaM-binding domain for Ca2+/CaM [25,26] The regulation of the CaMbinding domain by CnB may partly account for the slow and fast ... geometry is affected by CnB, the interaction between CnA and CnB may affect how the FKBP12/FK506 and CyPA/CsA complexes affect the substrate-binding cleft Thus, both the catalytic subunit and substrate...

9
473
0

An analysis of the inaugural address by g w bush in the u s president election 2004 from a perspective of discoure analysis

Ngày tải lên : 18/12/2013, 10:08

... country must abandon all the habits of racism, because we cannot carry the message of freedom and the baggage of bigotry at the same time (82) From the perspective of a single day, including this ... shows the choice of speech, writing, signing, etc (6) Code is what language or dialect, or style of language is being used (7) Message -form gives the style of the intended form of the message (8) ... the shipwreck of communism came years of relative quiet, years of repose, years of sabbatical - and then there came a day of fire (5) Nguyen Thi Huyen Le Vinh Uni 37 AN ANALYSIS OF THE INAUGURAL...

44
578
0

Tài liệu Báo cáo khoa học: Speciﬁc membrane binding of the carboxypeptidase Y inhibitor IC, a phosphatidylethanolamine-binding protein family member doc

Ngày tải lên : 19/02/2014, 05:20

... characterize the membrane binding of IC, a member of the PEBP family, we ﬁrst performed a liposome-binding assay of this inhibitor for the phosphatidylcholine (PC)-based liposomes (Fig 1) As shown in Fig ... For producing the C-terminal GFP-tagged IC (IC–GFP), the DNA fragment encoding GFP was inserted downstream of the IC-encoding gene in pYTF1 [5], and the S cerevisiae strain BY4741icD (MATa tfs1D::kanMX4 ... ﬂuorescence of IC–GFP was observed at the FM4-64stained vacuolar membranes and also the vacuolar 5378 lumens in the majority of yeast cells (70% of the cells grown at 72 h; right panels of Fig 3A ,B) Therefore,...

10
645
1

Báo cáo khoa học: Mutual effects of proton and sodium chloride on oxygenation of liganded human hemoglobin Oxygen afﬁnities of the a and b subunits potx

Ngày tải lên : 16/03/2014, 14:20

... NaCl effects on HbA subunits oxygenation S V Lepeshkevich and B M Dzhagarov the different conformational forms of HbA is a key factor in the complete description of the sigmoidal behavior of HbA ... constant of BR and the quantum yield of BR, in the presence of NaCl, gave a direct evidence of signiﬁcant functional heterogeneity for the a and b subunits in the last ligandbinding step (Table 2) The ... proposed to be achieved in two distinctly different ways The mechanism of the regulation can be unambiguously determined by the additional study of the GR, i.e the ligand rebinding from within the protein...

11
577
0

Báo cáo khoa học: Characterization of the lipopolysaccharide and b-glucan of the ﬁsh pathogen Francisella victoria ppt

Ngày tải lên : 30/03/2014, 10:20

... Deacylation of the LPS with m KOH in the presence of NaBH4 with subsequent fractionation by gel-chromatography on Sephadex G5 0 gave four fractions As in the case of acetic acid hydrolysis, the ... structures of core-lipid A backbone of different Francisella LPSs: (D) F tularensis, (E) F novicid and, (F) F Victoria regarding the structure of the most obscure region between Fuc R and Fuc L (data ... analysis of the LPS from related species is important in order to gain an understanding of the molecular basis of their biological properties, the host speciﬁcity and diversity of members of this...

12
397
0

Báo cáo khoa học: Cloning of a rat gene encoding the histo-blood group A enzyme Tissue expression of the gene and of the A and B antigens potx

Ngày tải lên : 31/03/2014, 09:20

... cloning of a new member of the ABO blood group glycosyltransferases, iGb3 synthase, that directs the synthesis of isoglobo-glycosphingolipids J Biol Chem 275, 25308–25314 Rat histo-blood group ... Inhibition of MT-450 rat mammary tumour growth by antibodies recognising subtypes of blood group antigen B Oncogene 18, 4485–4494 25 Yates, A.D & Watkins, W.M (1982) The biosynthesis of blood group ... that the four members of the ABO gene family are submitted to the same kind of selective pressure We generally observed a good concordance between the presence of the mRNA and of the A antigen...

8
499
0

Báo cáo toán học: "A Note on the Asymptotic Behavior of the Heights in b-Tries for b Large" ppt

Ngày tải lên : 07/08/2014, 06:20

... that from the deﬁnition of a b- trie we have hk = for n > b2 k and hk = for n n ≤ n ≤ b, k ≥ The asymptotic formula for hk in the matching region between (b) and (c) may be n obtained by evaluating ... I(A, b) = b! A eb log w−w dw = e b bb+1 b! A /b eb(log u−u+1) du Let α = b/ A Then, the asymptotic expansions of I are as follows: (i) b, A → ∞, α = b/ A > I = e−A Ab 1 b + O(A−2 ) − b! b/ A − A (b/ A ... asymptotic formulas were presented that apply for n large with b ﬁxed, for various ranges of k For purposes of comparison, we repeat these results below Theorem The distribution of the height of...

16
351
0

Báo cáo lâm nghiệp: "Influence of the form of nitrogen nutrition reductase activity in young black locus" doc

Ngày tải lên : 09/08/2014, 04:20

... enzyme activity (Fig 2) After 72 h of induction, the highest NR activity was found in the apical fully expanded leaf and corresponded with the highest nitrate content (Table I) When a new leaf ... expanded, the NR activity decreased in the previous leaf and the highest enzyme activity was found again in the new leaf (Fig 2) When the nitrate supply was withdrawn, the enzyme activity recovered ... with the advent of the N activity, indicates a relationship ase between both enzyme activities The low NR activity (!1 nmol N0 DW!h-!) of -mg2 nodulated plants could be greatly increased by nitrate...

4
202
0

Báo cáo y học: " A Novel Variable Number of Tandem Repeat of the Natriuretic Peptide Precursor B gene’s 5’-Flanking Region is Associated with Essential Hypertension among Japanese Females"

Ngày tải lên : 26/10/2012, 10:04

... AAGGAGGCACTGGGAGAGGGGAAAT -3’ (bases -1323 to -1299 from the major transcriptional initiation site) and antisense, 5’-AATTAGCTGGGCATGGTGGCAGGCG-3’ (bases -1075 to -1051)) that recognize part of ... accurate reflection of the function of the NPPB gene In the present study, the overall distribution of the VNTR genotype and the allele frequency were significantly different in females but not ... Hardy-Weinberg equilibrium values (P=0.972) Of note, the overall distribution of genotypes in females was significantly different between the EH and NT groups (p=0.039); the frequency of the 16-repeat...

7
612
1

Báo cáo y học: "Study of the early steps of the Hepatitis B Virus life cycle"

Ngày tải lên : 03/11/2012, 10:09

... cells but not the rat hepatocytes This binding could be inhibited by recombinant HBs but not by the recombinant LHBs The binding of SHBs with human hepatocytes was further supported by the observation ... colleagues, using the membranes of surgically obtained human liver as a target, further confirmed the role of LHBs in the HBV attachment [23] Recently, the attachment site of LHBs was functionally ... Influenza virus [13, 14] Recent data suggests that DHBV may use the endocytosis way for its entry [66] This hypothesis was supported by the observation of the conformation change of the large...

13
654
1

Tài liệu Engineering Mechanics - StaticsChapter 1Problem 1-1 Represent each of the following combinations of units in the correct SI form using an appropriate prefix: (a) m/ms (b) μkm (c) ks/mg (d) km⋅ μN Units Used: μN = 10−6N kmμkm = 109−6Gs = 10 s pptx

Ngày tải lên : 17/02/2014, 14:20

... and direction of the resultant FR = F + F2 + F of the three forces by first finding the resultant F' = F1 + F and then forming F R = F' + F Given: F = 30 N F = 20 N F = 50 N θ = 20 deg c = d = 28 ... direction of the resultant FR = F + F2 + F of the three forces by summing the rectangular or x, y components of the forces to obtain the resultant force Given: F = 30 N F = 20 N 46 © 2007 R C Hibbeler ... Determine the x and y components of each force acting on the gusset plate of the bridge truss Given: F = 200 lb c = F = 400 lb d = F = 300 lb e = F = 300 lb f = Solution: F 1x = F F 1x = −200 lb F 1y...

1.1K
1.1K
2

Tài liệu I MMIGRANT S MALL B USINESS OWNERS: A S IGNIFICANT AND G ROWING PART OF THE E CONOMY pdf

Ngày tải lên : 18/02/2014, 00:20

... industry by race and ethnicity Agriculture, forestry, fishing, and hunting Mining Construction Share of Share of Share of Foreign- foreignborn born Foreign- foreign- Foreign- foreignborn born Hispanic/ ... state 2010 ACS 5-year estimate Foreign- Foreign- Number of Foreignborn share born share foreign-born born share of of labor business of business population force owners owners California 27.1% 34.5% ... every five years by the Census Bureau, most recently in 2007 This gives definitive data about the number of businesses, the number of employees, the annual receipts and payroll of these businesses...

37
436
0

Tài liệu Báo cáo Y học: The effects of ring-size analogs of the antimicrobial peptide gramicidin S on phospholipid bilayer model membranes and on the growth of Acholeplasma laidlawii B ppt

Ngày tải lên : 21/02/2014, 01:21

... evidence from studies of the interaction of GS and its analogs with bacterial cells that the destruction of the integrity of the lipid bilayer of the inner membrane is the primary mode of antimicrobial ... thought to be common components of the outer monolayer of the lipid bilayer of bacterial membranes [18,19] Finally, we investigated the relative abilities of GS10, GS12 and GS14 to inhibit the growth ... not the case for GS12 We can ask whether or not the observed order of biophysical or biological potencies of GS itself and of the three ring-size analogs of GS studied here, namely GS @ GS14 > GS10...

10
683
0

Tài liệu Báo cáo Y học: Proteolysis of bovine b-lactoglobulin during thermal treatment in subdenaturing conditions highlights some structural features of the temperature-modiﬁed protein and yields fragments with low immunoreactivity pptx

Ngày tải lên : 21/02/2014, 15:20

... (triangles) or chymotrypsin (squares) at an : 10 enzyme/BLG ratio Native BLG, circles A rabbit anti-BLG Ig was used Immunoreactivity of the products of BLG hydrolysis Fig Position of the proteolytic ... most of the material that contributes to the microheterogeneity of the isolated fragments originate from further proteolytic degradation of a limited number of primary hydrolysis products All these ... with the ﬁgures reported in Table The extensive proteolysis observed with chymotrypsin resulted in the formation of appreciable amounts of proteolytic products capable of being retained by the gel,...

11
526
0

Báo cáo khoa học: Crystal structures of the apo form of b-fructofuranosidase from Biﬁdobacterium longum and its complex with fructose pot

Ngày tải lên : 06/03/2014, 00:21

... -NSTKWVITSGLNPG -GPPGTVGSGTQYFVGEFDG-T-TFTPDADTVYPGNST -Y- YGNQYECPGLIEVPIEN-S -DKSKWVMFLAINPG -SPLGGSINQYFVGDFDG -F- QFVPDD -SQ DGSGMWECPDFFPVTR -F- GSNGVETSSFGEPNEILKHVLKISLDD TKHDYYTIGTYDRVKDKFVPDN ... FNYDQ-PYRGQYHFSPQKNWMNDPNGLLYH NGTYHLFFQYNPGGIEWG-NISWGHA SIDLSVDTSEYNRPLIHFTPEKGWMNDPNGLFYDKTAKLWHLYFQYNPNATAWGQPLYWGHA -NQ-PYRTGFHFQPPKNWMNDPNGPMIY KGIYHLFYQWNPKGAVWG-NIVWAHS ... TKHDYYTIGTYDRVKDKFVPDN GFK -DATGTWECPDFYPVPL-N-STNGLDTSVYG -GSVRHVMKAGFE GHDWYTIGTYSPDRENFLPQNGLSLTGSTL 3PIG 1UYP 1Y4 W 3KF5 2AC1 2ADE 292 355 FRLWDCGHNYYAPQSF-N-VD G- RQIVYGWMSPFV Q PI-PMQDDGWCGQLTLPREITLGD...

17
521
0

Báo cáo khoa học: Puriﬁcation and structural study of the b form of human cAMP-dependent protein kinase inhibitor pdf

Ngày tải lên : 07/03/2014, 15:20

... determined by the method of Lowry et al [14] and the purity was examined by SDS/PAGE [15] Assay of human PKIb activity The activity of purified human PKIb was assayed by the inhibition of the catalytic ... recovery yield of 1.2% (Table 1) The purified PKIb showed a single band by SDS/PAGE (Fig 2) The assay of its activity demonstrated that the purified PKIb inhibited the catalytic subunit of cAPK with the ... PKIb in H2O The quantitative contributions of the individual amide I¢ component bands, determined by band fitting of the absorbance spectrum of Fig 4A, are shown in Fig and Table From Table 2, the...

6
531
0