equations of the form y b g dt f

Tài liệu Báo cáo Y học: Purification, characterization, immunolocalization and structural analysis of the abundant cytoplasmic b-amylase from Calystegia sepium (hedge bindweed) rhizomes ppt

Tài liệu Báo cáo Y học: Purification, characterization, immunolocalization and structural analysis of the abundant cytoplasmic b-amylase from Calystegia sepium (hedge bindweed) rhizomes ppt

... that the < /b> distance of < /b> 7.89 A between Glu183 (homologous to Glu186 of < /b> soybean b- amylase) and Glu381 (homologous to Glu380 of < /b> soybean b- amylase) of < /b> the < /b> C sepium b- amylase, fits the < /b> inverting hydrolytic ... in all b- amylases from plants and microorganisms (e .g 97Gly-Gly-Asn-Val-GlyAsp-Ala-Val104 of < /b> Calystegia b- amylase and 96Gly-GlyAsn-Val-Gly-Asp-Ile-Val103 of < /b> the < /b> soybean b- amylase) Docking experiments ... and Cys344) are homologous to those found in soybean b- amylase (Cys82, Cys97, Cys208 and Cys343) On the < /b> analogy of < /b> the < /b> soybean b- amylase, the < /b> active site of < /b> the < /b> C sepium b- amylase most probably...

Ngày tải lên: 22/02/2014, 07:20

11 611 0
Báo cáo Y học: Solution structure of the Alzheimer amyloid b-peptide (1–42) in an apolar microenvironment Similarity with a virus fusion domain potx

Báo cáo Y học: Solution structure of the Alzheimer amyloid b-peptide (1–42) in an apolar microenvironment Similarity with a virus fusion domain potx

... interaction and destabilization is different in the < /b> case of < /b> Ab, Fig Comparison of < /b> the < /b> shapes of < /b> the < /b> lowest energy structure of < /b> HA_fd (A) and of < /b> the < /b> 1–35 region of < /b> Ab-(1–42) (B) Residue side chains ... semiconserved in yellow but it is fair to say that the < /b> similarity with the < /b> fusion domain of < /b> a virus is strongly suggestive of < /b> membrane disruption The < /b> recent observation of < /b> a strong synergism between Ab and ... analysis of < /b> NOESY spectra evidenced only the < /b> presence of < /b> sequential, short-range contacts, suggesting the < /b> absence of < /b> any preferential conformation In the < /b> end, we found that stable, mM solutions of...

Ngày tải lên: 08/03/2014, 09:20

7 624 0
Báo cáo Y học: Role of conserved residues within helices IV and VIII of the oxaloacetate decarboxylase b subunit in the energy coupling mechanism of the Na+ pump ppt

Báo cáo Y học: Role of conserved residues within helices IV and VIII of the oxaloacetate decarboxylase b subunit in the energy coupling mechanism of the Na+ pump ppt

... protocol For the < /b> PCR fragment encoding the < /b> N-terminal part of < /b> the < /b> b subunit, primers Kpn2Ifor (5¢-GCTTCGGCGGCCTGCTCTCC-3¢) and N373Drev (5¢-AGCCGATCAGCGGATCGATTTTGTG CCGG-3¢) were used For the < /b> PCR fragment ... Simultaneously, the < /b> Na+ binding ligands are probably rearranged into a geometry, which is less favourable for Na+ binding The < /b> binding of < /b> Na+ to free OadB (without carboxybiotin bound) with an affinity of < /b> 20– ... inhibitory effect of < /b> Na+ were fitted to an exponential decay Effect of < /b> Na+ on tryptic hydrolysis of < /b> the < /b> oxaloacetate decarboxylase b subunit Protection from proteolytic digestion of < /b> the < /b> b subunit...

Ngày tải lên: 08/03/2014, 23:20

8 509 0
Báo cáo Y học: Engineering and mechanistic studies of the Arabidopsis FAE1 b-ketoacyl-CoA synthase, FAE1 KCS pot

Báo cáo Y học: Engineering and mechanistic studies of the Arabidopsis FAE1 b-ketoacyl-CoA synthase, FAE1 KCS pot

... 5¢-GAACGTGTTGGTTCCGC GTGGTAGCGCATGTGATGATCCGTCCTCG-3¢ and an antisense primer 5¢-CACATGCGCTACCACGCGG AACCAACACGTTCCGTGAAGAAGTATC-3¢ were used (underlined sequence encodes for thrombin cleavage ... Solubilization and purification of < /b> N-terminus His-tagged FAE1 KCS Fig Hydropathy analysis of < /b> FAE1 KCS (A) Hydropathy plot of < /b> FAE1 KCS indicating the < /b> presence of < /b> several hydrophobic regions The < /b> ... enzyme Taken together, the < /b> analysis of < /b> the < /b> decarboxylation activity and characterization of < /b> the < /b> mutants of < /b> the < /b> putative catalytic triad strongly support the < /b> hypothesis that the < /b> membrane-bound FAE1...

Ngày tải lên: 24/03/2014, 03:21

9 457 0
Báo cáo Y học: Substrate selectivity and sensitivity to inhibition by FK506 and cyclosporin A of calcineurin heterodimers composed of the a or b catalytic subunit potx

Báo cáo Y học: Substrate selectivity and sensitivity to inhibition by FK506 and cyclosporin A of calcineurin heterodimers composed of the a or b catalytic subunit potx

... noncompetitively by binding to the < /b> CnB-binding helix, CnB, and one side of < /b> the < /b> substrate-binding cleft of < /b> the < /b> catalytic site to alter the < /b> active-site geometry [16,17,20,22] As the < /b> mechanism of < /b> inhibition of < /b> ... CaM-binding domain and the < /b> CnBbinding helix and increases the < /b> affinity of < /b> the < /b> CaM-binding domain for Ca2+/CaM [25,26] The < /b> regulation of < /b> the < /b> CaMbinding domain by CnB may partly account for the < /b> slow and fast ... geometry is affected by CnB, the < /b> interaction between CnA and CnB may affect how the < /b> FKBP12/FK506 and CyPA/CsA complexes affect the < /b> substrate-binding cleft Thus, both the < /b> catalytic subunit and substrate...

Ngày tải lên: 24/03/2014, 03:21

9 473 0
An analysis of the inaugural address by g w bush in the u s president election 2004 from a perspective of discoure analysis

An analysis of the inaugural address by g w bush in the u s president election 2004 from a perspective of discoure analysis

... country must abandon all the < /b> habits of < /b> racism, because we cannot carry the < /b> message of < /b> freedom and the < /b> baggage of < /b> bigotry at the < /b> same time (82) From the < /b> perspective of < /b> a single day, including this ... shows the < /b> choice of < /b> speech, writing, signing, etc (6) Code is what language or dialect, or style of < /b> language is being used (7) Message -form < /b> gives the < /b> style of < /b> the < /b> intended form < /b> of < /b> the < /b> message (8) ... the < /b> shipwreck of < /b> communism came years of < /b> relative quiet, years of < /b> repose, years of < /b> sabbatical - and then there came a day of < /b> fire (5) Nguyen Thi Huyen Le Vinh Uni 37 AN ANALYSIS OF < /b> THE < /b> INAUGURAL...

Ngày tải lên: 18/12/2013, 10:08

44 579 0
Tài liệu Báo cáo khoa học: Specific membrane binding of the carboxypeptidase Y inhibitor IC, a phosphatidylethanolamine-binding protein family member doc

Tài liệu Báo cáo khoa học: Specific membrane binding of the carboxypeptidase Y inhibitor IC, a phosphatidylethanolamine-binding protein family member doc

... characterize the < /b> membrane binding of < /b> IC, a member of < /b> the < /b> PEBP family, we first performed a liposome-binding assay of < /b> this inhibitor for the < /b> phosphatidylcholine (PC)-based liposomes (Fig 1) As shown in Fig ... For producing the < /b> C-terminal GFP-tagged IC (IC–GFP), the < /b> DNA fragment encoding GFP was inserted downstream of < /b> the < /b> IC-encoding gene in pYTF1 [5], and the < /b> S cerevisiae strain BY4741icD (MATa tfs1D::kanMX4 ... fluorescence of < /b> IC–GFP was observed at the < /b> FM4-64stained vacuolar membranes and also the < /b> vacuolar 5378 lumens in the < /b> majority of < /b> yeast cells (70% of < /b> the < /b> cells grown at 72 h; right panels of < /b> Fig 3A ,B) Therefore,...

Ngày tải lên: 19/02/2014, 05:20

10 646 1
Báo cáo khoa học: Mutual effects of proton and sodium chloride on oxygenation of liganded human hemoglobin Oxygen affinities of the a and b subunits potx

Báo cáo khoa học: Mutual effects of proton and sodium chloride on oxygenation of liganded human hemoglobin Oxygen affinities of the a and b subunits potx

... NaCl effects on HbA subunits oxygenation S V Lepeshkevich and B M Dzhagarov the < /b> different conformational forms of < /b> HbA is a key factor in the < /b> complete description of < /b> the < /b> sigmoidal behavior of < /b> HbA ... constant of < /b> BR and the < /b> quantum yield of < /b> BR, in the < /b> presence of < /b> NaCl, gave a direct evidence of < /b> significant functional heterogeneity for the < /b> a and b subunits in the < /b> last ligandbinding step (Table 2) The < /b> ... proposed to be achieved in two distinctly different ways The < /b> mechanism of < /b> the < /b> regulation can be unambiguously determined by the < /b> additional study of < /b> the < /b> GR, i.e the < /b> ligand rebinding from within the < /b> protein...

Ngày tải lên: 16/03/2014, 14:20

11 577 0
Báo cáo khoa học: Characterization of the lipopolysaccharide and b-glucan of the fish pathogen Francisella victoria ppt

Báo cáo khoa học: Characterization of the lipopolysaccharide and b-glucan of the fish pathogen Francisella victoria ppt

... Deacylation of < /b> the < /b> LPS with m KOH in the < /b> presence of < /b> NaBH4 with subsequent fractionation by gel-chromatography on Sephadex G5 0 gave four fractions As in the < /b> case of < /b> acetic acid hydrolysis, the < /b> ... structures of < /b> core-lipid A backbone of < /b> different Francisella LPSs: (D) F tularensis, (E) F novicid and, (F) F Victoria regarding the < /b> structure of < /b> the < /b> most obscure region between Fuc R and Fuc L (data ... analysis of < /b> the < /b> LPS from related species is important in order to gain an understanding of < /b> the < /b> molecular basis of < /b> their biological properties, the < /b> host specificity and diversity of < /b> members of < /b> this...

Ngày tải lên: 30/03/2014, 10:20

12 397 0
Báo cáo khoa học: Cloning of a rat gene encoding the histo-blood group A enzyme Tissue expression of the gene and of the A and B antigens potx

Báo cáo khoa học: Cloning of a rat gene encoding the histo-blood group A enzyme Tissue expression of the gene and of the A and B antigens potx

... cloning of < /b> a new member of < /b> the < /b> ABO blood group glycosyltransferases, iGb3 synthase, that directs the < /b> synthesis of < /b> isoglobo-glycosphingolipids J Biol Chem 275, 25308–25314 Rat histo-blood group ... Inhibition of < /b> MT-450 rat mammary tumour growth by antibodies recognising subtypes of < /b> blood group antigen B Oncogene 18, 4485–4494 25 Yates, A.D & Watkins, W.M (1982) The < /b> biosynthesis of < /b> blood group ... that the < /b> four members of < /b> the < /b> ABO gene family are submitted to the < /b> same kind of < /b> selective pressure We generally observed a good concordance between the < /b> presence of < /b> the < /b> mRNA and of < /b> the < /b> A antigen...

Ngày tải lên: 31/03/2014, 09:20

8 499 0
Báo cáo toán học: "A Note on the Asymptotic Behavior of the Heights in b-Tries for b Large" ppt

Báo cáo toán học: "A Note on the Asymptotic Behavior of the Heights in b-Tries for b Large" ppt

... that from the < /b> definition of < /b> a b- trie we have hk = for n > b2 k and hk = for n n ≤ n ≤ b, k ≥ The < /b> asymptotic formula for hk in the < /b> matching region between (b) and (c) may be n obtained by evaluating ... I(A, b) = b! A eb log w−w dw = e b bb+1 b! A /b eb(log u−u+1) du Let α = b/ A Then, the < /b> asymptotic expansions of < /b> I are as follows: (i) b, A → ∞, α = b/ A > I = e−A Ab 1 b + O(A−2 ) − b! b/ A − A (b/ A ... asymptotic formulas were presented that apply for n large with b fixed, for various ranges of < /b> k For purposes of < /b> comparison, we repeat these results below Theorem The < /b> distribution of < /b> the < /b> height of...

Ngày tải lên: 07/08/2014, 06:20

16 352 0
Báo cáo lâm nghiệp: "Influence of the form of nitrogen nutrition reductase activity in young black locus" doc

Báo cáo lâm nghiệp: "Influence of the form of nitrogen nutrition reductase activity in young black locus" doc

... enzyme activity (Fig 2) After 72 h of < /b> induction, the < /b> highest NR activity was found in the < /b> apical fully expanded leaf and corresponded with the < /b> highest nitrate content (Table I) When a new leaf ... expanded, the < /b> NR activity decreased in the < /b> previous leaf and the < /b> highest enzyme activity was found again in the < /b> new leaf (Fig 2) When the < /b> nitrate supply was withdrawn, the < /b> enzyme activity recovered ... with the < /b> advent of < /b> the < /b> N activity, indicates a relationship ase between both enzyme activities The < /b> low NR activity (!1 nmol N0 DW!h-!) of < /b> -mg2 nodulated plants could be greatly increased by nitrate...

Ngày tải lên: 09/08/2014, 04:20

4 202 0
Báo cáo y học: " A Novel Variable Number of Tandem Repeat of the Natriuretic Peptide Precursor B gene’s 5’-Flanking Region is Associated with Essential Hypertension among Japanese Females"

Báo cáo y học: " A Novel Variable Number of Tandem Repeat of the Natriuretic Peptide Precursor B gene’s 5’-Flanking Region is Associated with Essential Hypertension among Japanese Females"

... AAGGAGGCACTGGGAGAGGGGAAAT -3’ (bases -1323 to -1299 from the < /b> major transcriptional initiation site) and antisense, 5’-AATTAGCTGGGCATGGTGGCAGGCG-3’ (bases -1075 to -1051)) that recognize part of < /b> ... accurate reflection of < /b> the < /b> function of < /b> the < /b> NPPB gene In the < /b> present study, the < /b> overall distribution of < /b> the < /b> VNTR genotype and the < /b> allele frequency were significantly different in females but not ... Hardy-Weinberg equilibrium values (P=0.972) Of < /b> note, the < /b> overall distribution of < /b> genotypes in females was significantly different between the < /b> EH and NT groups (p=0.039); the < /b> frequency of < /b> the < /b> 16-repeat...

Ngày tải lên: 26/10/2012, 10:04

7 612 1
Báo cáo y học: "Study of the early steps of the Hepatitis B Virus life cycle"

Báo cáo y học: "Study of the early steps of the Hepatitis B Virus life cycle"

... cells but not the < /b> rat hepatocytes This binding could be inhibited by recombinant HBs but not by the < /b> recombinant LHBs The < /b> binding of < /b> SHBs with human hepatocytes was further supported by the < /b> observation ... colleagues, using the < /b> membranes of < /b> surgically obtained human liver as a target, further confirmed the < /b> role of < /b> LHBs in the < /b> HBV attachment [23] Recently, the < /b> attachment site of < /b> LHBs was functionally ... Influenza virus [13, 14] Recent data suggests that DHBV may use the < /b> endocytosis way for its entry [66] This hypothesis was supported by the < /b> observation of < /b> the < /b> conformation change of < /b> the < /b> large...

Ngày tải lên: 03/11/2012, 10:09

13 654 1
Tài liệu Engineering Mechanics - StaticsChapter 1Problem 1-1 Represent each of the following combinations of units in the correct SI form using an appropriate prefix: (a) m/ms (b) μkm (c) ks/mg (d) km⋅ μN Units Used: μN = 10−6N kmμkm = 109−6Gs = 10 s pptx

Tài liệu Engineering Mechanics - StaticsChapter 1Problem 1-1 Represent each of the following combinations of units in the correct SI form using an appropriate prefix: (a) m/ms (b) μkm (c) ks/mg (d) km⋅ μN Units Used: μN = 10−6N kmμkm = 109−6Gs = 10 s pptx

... and direction of < /b> the < /b> resultant FR = F + F2 + F of < /b> the < /b> three forces by first finding the < /b> resultant F' = F1 + F and then forming F R = F' + F Given: F = 30 N F = 20 N F = 50 N θ = 20 deg c = d = 28 ... direction of < /b> the < /b> resultant FR = F + F2 + F of < /b> the < /b> three forces by summing the < /b> rectangular or x, y < /b> components of < /b> the < /b> forces to obtain the < /b> resultant force Given: F = 30 N F = 20 N 46 © 2007 R C Hibbeler ... Determine the < /b> x and y < /b> components of < /b> each force acting on the < /b> gusset plate of < /b> the < /b> bridge truss Given: F = 200 lb c = F = 400 lb d = F = 300 lb e = F = 300 lb f = Solution: F 1x = F F 1x = −200 lb F 1y...

Ngày tải lên: 17/02/2014, 14:20

1,1K 1,1K 2
Tài liệu I MMIGRANT S MALL B USINESS OWNERS: A S IGNIFICANT AND G ROWING PART OF THE E CONOMY pdf

Tài liệu I MMIGRANT S MALL B USINESS OWNERS: A S IGNIFICANT AND G ROWING PART OF THE E CONOMY pdf

... industry by race and ethnicity Agriculture, forestry, fishing, and hunting Mining Construction Share of < /b> Share of < /b> Share of < /b> Foreign- foreignborn born Foreign- foreign- Foreign- foreignborn born Hispanic/ ... state 2010 ACS 5-year estimate Foreign- Foreign- Number of < /b> Foreignborn share born share foreign-born born share of < /b> of labor business of < /b> business population force owners owners California 27.1% 34.5% ... every five years by the < /b> Census Bureau, most recently in 2007 This gives definitive data about the < /b> number of < /b> businesses, the < /b> number of < /b> employees, the < /b> annual receipts and payroll of < /b> these businesses...

Ngày tải lên: 18/02/2014, 00:20

37 436 0
Tài liệu Báo cáo Y học: The effects of ring-size analogs of the antimicrobial peptide gramicidin S on phospholipid bilayer model membranes and on the growth of Acholeplasma laidlawii B ppt

Tài liệu Báo cáo Y học: The effects of ring-size analogs of the antimicrobial peptide gramicidin S on phospholipid bilayer model membranes and on the growth of Acholeplasma laidlawii B ppt

... evidence from studies of < /b> the < /b> interaction of < /b> GS and its analogs with bacterial cells that the < /b> destruction of < /b> the < /b> integrity of < /b> the < /b> lipid bilayer of < /b> the < /b> inner membrane is the < /b> primary mode of < /b> antimicrobial ... thought to be common components of < /b> the < /b> outer monolayer of < /b> the < /b> lipid bilayer of < /b> bacterial membranes [18,19] Finally, we investigated the < /b> relative abilities of < /b> GS10, GS12 and GS14 to inhibit the < /b> growth ... not the < /b> case for GS12 We can ask whether or not the < /b> observed order of < /b> biophysical or biological potencies of < /b> GS itself and of < /b> the < /b> three ring-size analogs of < /b> GS studied here, namely GS @ GS14 > GS10...

Ngày tải lên: 21/02/2014, 01:21

10 683 0
Tài liệu Báo cáo Y học: Proteolysis of bovine b-lactoglobulin during thermal treatment in subdenaturing conditions highlights some structural features of the temperature-modified protein and yields fragments with low immunoreactivity pptx

Tài liệu Báo cáo Y học: Proteolysis of bovine b-lactoglobulin during thermal treatment in subdenaturing conditions highlights some structural features of the temperature-modified protein and yields fragments with low immunoreactivity pptx

... (triangles) or chymotrypsin (squares) at an : 10 enzyme/BLG ratio Native BLG, circles A rabbit anti-BLG Ig was used Immunoreactivity of < /b> the < /b> products of < /b> BLG hydrolysis Fig Position of < /b> the < /b> proteolytic ... most of < /b> the < /b> material that contributes to the < /b> microheterogeneity of < /b> the < /b> isolated fragments originate from further proteolytic degradation of < /b> a limited number of < /b> primary hydrolysis products All these ... with the < /b> figures reported in Table The < /b> extensive proteolysis observed with chymotrypsin resulted in the < /b> formation of < /b> appreciable amounts of < /b> proteolytic products capable of < /b> being retained by the < /b> gel,...

Ngày tải lên: 21/02/2014, 15:20

11 526 0
Báo cáo khoa học: Crystal structures of the apo form of b-fructofuranosidase from Bifidobacterium longum and its complex with fructose pot

Báo cáo khoa học: Crystal structures of the apo form of b-fructofuranosidase from Bifidobacterium longum and its complex with fructose pot

... -NSTKWVITSGLNPG -GPPGTVGSGTQYFVGEFDG-T-TFTPDADTVYPGNST -Y-< /b> YGNQYECPGLIEVPIEN-S -DKSKWVMFLAINPG -SPLGGSINQYFVGDFDG -F- QFVPDD -SQ DGSGMWECPDFFPVTR -F- GSNGVETSSFGEPNEILKHVLKISLDD TKHDYYTIGTYDRVKDKFVPDN ... FNYDQ-PYRGQYHFSPQKNWMNDPNGLLYH NGTYHLFFQYNPGGIEWG-NISWGHA SIDLSVDTSEYNRPLIHFTPEKGWMNDPNGLFYDKTAKLWHLYFQYNPNATAWGQPLYWGHA -NQ-PYRTGFHFQPPKNWMNDPNGPMIY KGIYHLFYQWNPKGAVWG-NIVWAHS ... TKHDYYTIGTYDRVKDKFVPDN GFK -DATGTWECPDFYPVPL-N-STNGLDTSVYG -GSVRHVMKAGFE GHDWYTIGTYSPDRENFLPQNGLSLTGSTL 3PIG 1UYP 1Y4< /b> W 3KF5 2AC1 2ADE 292 355 FRLWDCGHNYYAPQSF-N-VD G- RQIVYGWMSPFV Q PI-PMQDDGWCGQLTLPREITLGD...

Ngày tải lên: 06/03/2014, 00:21

17 522 0
Báo cáo khoa học: Purification and structural study of the b form of human cAMP-dependent protein kinase inhibitor pdf

Báo cáo khoa học: Purification and structural study of the b form of human cAMP-dependent protein kinase inhibitor pdf

... determined by the < /b> method of < /b> Lowry et al [14] and the < /b> purity was examined by SDS/PAGE [15] Assay of < /b> human PKIb activity The < /b> activity of < /b> purified human PKIb was assayed by the < /b> inhibition of < /b> the < /b> catalytic ... recovery yield of < /b> 1.2% (Table 1) The < /b> purified PKIb showed a single band by SDS/PAGE (Fig 2) The < /b> assay of < /b> its activity demonstrated that the < /b> purified PKIb inhibited the < /b> catalytic subunit of < /b> cAPK with the < /b> ... PKIb in H2O The < /b> quantitative contributions of < /b> the < /b> individual amide I¢ component bands, determined by band fitting of < /b> the < /b> absorbance spectrum of < /b> Fig 4A, are shown in Fig and Table From Table 2, the...

Ngày tải lên: 07/03/2014, 15:20

6 531 0
w