ed ex batch edits a typical example
A typical small-scale chlorine leak and dispersion simulation in industrial facilities
... Based on large-scale field experiments and wind tunnel test data, using certain simplifications and assumptions, concentrations of heavy gas cloud and its main parameters are calculated A typical ... concentration reached the maximum value after 20s and then gradually dropped to a constant value at point A The concentration at point A was overlapped by the initial concentration and the reflected ... cause-consequence analysis and fishbone diagram was adopted here A cause-consequence analysis is used to clarify the causes of an accident and pose a combination of causal relationships using concise text and...
Ngày tải lên: 05/09/2013, 16:11
Đề tài " On the Julia set of a typical quadratic polynomial with a Siegel disk " ppt
... asymptotically universal bounds: n area(P0 An+2 ) n area(P0 n area(Pqn+1 An+2 ) n area(Pqn+1 area(Qn An+2 ) area(Qn An+2 ) An+2 ) An+2 ) n n area(P0 ∪ P0 ), n n area(Pqn+1 ∪ Pqn+1 ), area(Qn ∪ Qn ) 0 ... rational maps with Siegel disks; see for example [P2] and [Mc2] for the case of quadratic polynomials, and [Z1] and [YZ] for variants in the case of cubic polynomials and quadratic rational maps ... a constant which is asymptotically universal Similarly, bn , we say that an and bn are comparable up to a constant when an which is asymptotically universal Finally, let {an = an (x)} and {bn...
Ngày tải lên: 14/03/2014, 22:20
Báo cáo khoa học: Kinetic hybrid models composed of mechanistic and simplified enzymatic rate laws – a promising method for speeding up the kinetic modelling of complex metabolic networks pptx
... the ATP consumption rate appears at a 3.3-fold increased value of kATPase as compared to the value k0 ATPase ẳ 1:6 h At values of kATPase exceeding seven-fold of its normal value, no stationary ... concentration, and lactate concentration, within the following physiologically feasible ranges: k kATPase k0 ATPase ATPase (small variation of the energetic load) k kATPase k0 ATPase ATPase (large variation ... cellular kinases and phosphatases as potential chemical modiers, and all cellular membranes as potential activating or inactivating scaffolds However, the experimental effort actually required can...
Ngày tải lên: 23/03/2014, 06:20
Báo cáo khoa học: NMR solution structure of Cn12, a novel peptide from the Mexican scorpion Centruroides noxius with a typical b-toxin sequence but with a-like physiological activity doc
... sections of the chromatogram (B) Direct Edman degradation of native peptide and reduced and alkylated samples provided unequivocal amino-acid sequence identification from Arg1 to Asp36 Further sequencing ... Fig Final purification and amino-acid sequence determination of Cn12 (A) A sample of fraction II-4 from a CM-cellulose ionexchange column [33] containing mg protein was applied to an analytical C18 ... the same conditions as reported [34] Determination of amino-acid sequence and MS analysis The full amino-acid sequence of the toxin was obtained by direct Edman degradation, using an automatic...
Ngày tải lên: 23/03/2014, 12:20
Báo cáo khoa học: The thermodynamic analysis of protein stabilization by sucrose and glycerol against pressure-induced unfolding The typical example of the 33-kDa protein from spinach photosystem II docx
... used as a new approach to identify several conformers [37–40] Acknowledgements This work was supported by a grant from National Natural Science Foundation of China and a grant from INSERM/Academia ... native « denatured transition in the absence of protectants is 2.6 kcalÆmol)1, a value in good agreement with those reported by Tanaka et al (2.8 kcalÆmol)1) [2] The change in P1/2 is caused by effects ... glycerol addition were calculated and listed in Table It was found that the TP1/2* caused by the net increases in DG were lower than the experimental P1/2 Typically, the difference between P1/2 and...
Ngày tải lên: 31/03/2014, 01:20
matlab primer (6th ed) - kermit sigmon & timothy a. davis
... from MATLAB has been added Sparse matrix ordering and visualization has been added to Chapter 13 Large matrices that arise in practical applications often have many zero entries Taking advantage ... Desktop MATLAB has an extensive graphical user interface When MATLAB starts, the MATLAB window will appear, with several subwindows and menu bars All of MATLAB’s windows are docked, which means that ... assigned to a variable for future use If the variable name and sign are omitted, a variable DQV (for answer) is automatically created to which the result is assigned A statement is normally terminated...
Ngày tải lên: 08/04/2014, 10:18
Báo cáo sinh học: " A new example of viral intein in Mimivirus" ppt
... distance was applied to compute evolutionary distances The gamma shape parameter (alpha) was estimated using the GZ-GAMMA program [30] The sequence and annotation data for the Mimivirus PolB and intein ... viruses and extremophilic archaeabacteria Mesophilic euryarchaea species similar to the methanogens associated with rumen [21,22] or related species found in human beings [23] might have mediated ... SSEYKLLDIKQQTLKVLTNSFYGYMGWNLARWYCHPCAEATTAWGRHFIR PHEAKILDVRQQAYKVLANSYYGYMGWANARWFCRECAESVTAWGRYYIS PLSQALKIIMNAFYGVLGTTACRFFDPRLASSITMRGHQIMR AFSQAIKIIMNSFYGVLGSSGCRFFDTRLASSITMRGHEIMK SALRACLNGRQLAFKLCANSLYGFTGASRGKLPCFEISQSVTGFGREMII...
Ngày tải lên: 18/06/2014, 22:20
báo cáo hóa học:" A new example of viral intein in Mimivirus" potx
... distance was applied to compute evolutionary distances The gamma shape parameter (alpha) was estimated using the GZ-GAMMA program [30] The sequence and annotation data for the Mimivirus PolB and intein ... viruses and extremophilic archaeabacteria Mesophilic euryarchaea species similar to the methanogens associated with rumen [21,22] or related species found in human beings [23] might have mediated ... SSEYKLLDIKQQTLKVLTNSFYGYMGWNLARWYCHPCAEATTAWGRHFIR PHEAKILDVRQQAYKVLANSYYGYMGWANARWFCRECAESVTAWGRYYIS PLSQALKIIMNAFYGVLGTTACRFFDPRLASSITMRGHQIMR AFSQAIKIIMNSFYGVLGSSGCRFFDTRLASSITMRGHEIMK SALRACLNGRQLAFKLCANSLYGFTGASRGKLPCFEISQSVTGFGREMII...
Ngày tải lên: 20/06/2014, 04:20
Báo cáo hóa học: " Research Article RRES: A Novel Approach to the Partitioning Problem for a Typical Subset of System Graphs" potx
... directed acyclic graph (DAG) The objective function incorporates several constraints on the available silicon area (hardware capacity), B Knerr et al memory (software capacity), and latency as a ... control-oriented functionality (an ARM for the signalling part and a StarCore for the multimedia part) It features several hardware accelerating units (ASICs), for the more data-oriented and computation ... current stage of the algorithm based on the decision about already mapped vertices and estimations about yet unmapped vertices The local phase value of a vertex is an individual indicator that expresses...
Ngày tải lên: 22/06/2014, 06:20
Báo cáo y học: "The potential of human regulatory T cells generated ex vivo as a treatment for lupus and other chronic inflammatory diseases" pot
... 39 Yamamoto H, Hirayama M, Genyea C, Kaplan J: TGF-beta mediates natural suppressor activity of IL-2-activated lymphocytes J Immunol 1994, 152:3842-3847 40 Gray JD, Hirokawa M, Horwitz DA: The ... subset as a possible cause of autoimmune disease J Exp Med 1985, 161:72-87 Kuniyasu Y, Takahashi T, Itoh M, Shimizu J, Toda G, Sakaguchi S: Naturally anergic and suppressive CD25+ CD4+ T cells as a ... production and functional properties [35], our laboratory has accumulated data that these effects can be overcome by IL-2 and can be superceded by costimulatory activities The net effect is that TGF-β...
Ngày tải lên: 09/08/2014, 03:24
Báo cáo y học: "Association of the FCRL3 gene with rheumatoid arthritis: a further example of population specificity" ppsx
... deiminase 4, are associated with rheumatoid arthritis Nat Genet 2003, 34:395-402 Ikari K, Kuwahara M, Nakamura T, Momohara S, Hara M, Yamanaka H, Tomatsu T, Kamatani N: Association between PADI4 and ... Suzuki A, Yamada R, Chang X, Tokuhiro S, Sawada T, Suzuki M, Nagasaki M, Nakayama-Hamada M, Kawaida R, Ono M, et al.: Functional haplotypes of PADI4, encoding citrullinating enzyme peptidylarginine ... Ikari K, Momohara S, Inoue E, Tomatsu T, Hara M, Yamanaka H, Kamatani N: Haplotype analysis revealed no association between the PTPN22 gene and RA in a Japanese population Rheumatology (Oxford)...
Ngày tải lên: 09/08/2014, 08:22
Exergoeconomic performance optimization for a steadyflow endoreversible refrigeration model including six typical cycles
... between and is a heating branch with constant thermal capacity (mass flow rate and specific heat product) Cin ; the processes between and 4, and and are two cooling branches with constant thermal capacity ... infinite heat sink at temperature TH and an infinite heat source at temperature TL is shown in Figure In this T-s diagram, the processes between and , as well as between and are two adiabatic branches; ... Yang B, Sun F Exergoeconomic performance optimization of an endoreversible intercooled regenerated Brayton cogeneration plant Part 1: thermodynamic model and parameter analyses Int J Energy and...
Ngày tải lên: 05/09/2013, 17:08
A relational SQL Example
... 8.1 Relational Database Analysis Relational database analysis is a process whereby you identify and classify into groups the information you need to store in a database In addition, you ... don't use an SSN For example, in Canada a person may have a Social Insurance Number (SIN), and in the United Kingdom, a person may have a National Identifier (NI) Therefore, calling an attribute ... types at your disposal: CHAR (or NCHAR) A fixed-length character type right-padded with space characters up to its constraining size VARCHAR2 (or NVARCHAR2) A varying-length character type that can...
Ngày tải lên: 29/09/2013, 09:20
A STUDY ON HYPERBOLE IN SHORT STORIES OF SOME TYPICAL VIETNAMESE AND AMERICAN WRITERS
... contrastive features of arrangement in which they occur This meaning is abstract and generalized‖ (Hoang Tat Truong, 1993:53) Every language has grammatical systems We can explain what grammatical ... O Henry) It means that her thought is unchangeable and firm ―As soon as the ex- coachman had recovered his feet and his wits he hastened as fast as he could eastward toward Broadway‖ (In ―the fifth ... ―Gallons,‖ said the burglar ―If all the snakes I’ve used the oil of was strung out in a row they’d reach eight times as far as Saturn, and the rattles could be heard at Valparaiso, Indiana, and back.‖(In...
Ngày tải lên: 11/12/2013, 23:51
A STUDY ON TRANSLATION OF TYPICAL TERMS USED IN LABOR LAW FROM VIETNAMESE INTO ENGLISH
... equivalent text, likewise called a "translation," that communicates the same message in another 15 language The text to be translated is called the "source text," and the language that it is to be translated ... field It may be a word, an expression, a symbol, a chemical or mathematical formula, a scientific name in Latin A term in a specialized language distinguished form a word in general language by ... worker populations Occupational hazards that are of a traumatic nature (such as falls by roofers) are not considered to be occupational diseases ( From Wikipedia) 25 An occupational disease arises...
Ngày tải lên: 11/12/2013, 23:55
A study of the dominant topics in some typical works of augustan period (1700 1745) = nghiên cứu về những chủ đề nổi bật trong một số tác phẩm điển hình thời kì augustan (1700 1745)
... Crusoe” was translated into many languages and its main character, Robinson Crusoe was admired by hundreds thousand readers He was an actual hero who could win fate and proved that human kind ... Clarissa began to go mad and was left by Lovelace Clarissa finally died and Lovelace was killed in a fight The life of Clarissa was a chain of misery and agony Firstly, she was the victim of an ... daughter in a successful landed family She was a young lady of "great beauty and merit" and discretion Lovelace was a handsome man and a direct offspring of the aristocratic rakes who was chasing...
Ngày tải lên: 14/12/2013, 00:41
Tài liệu Processing a Batch SQL Statement docx
... the Command is executed The Oracle NET data provider does not support batch SQL statements To execute a batch query against an Oracle database it is necessary to use an Oracle package that returns ... Details];"; if (dataSetRadioButton.Checked) { SqlDataAdapter da = new SqlDataAdapter(sqlText, ConfigurationSettings.AppSettings["Sql_ConnectString"]); // Map the automatically generated table names ... the DataAdapter For more information about using table mappings, see Recipe 2.16 Data relationships between the tables added with a batch query must be created programmatically As with non-batch...
Ngày tải lên: 14/12/2013, 18:16
Tài liệu Performing Batch Updates with a DataAdapter doc
... a DataAdapter is used to update the data source with changes made to disconnected data in a DataSet or DataTable, a RowUpdating event is raised before the command to update each changed row executes ... DataAdapter Instead, the update is performed by executing the batch SQL statement created by this event handler The C# code is shown in Example 9-16 Example 9-16 File: CustomAdapterBatchUpdateForm.cs ... update da.RowUpdating += new SqlRowUpdatingEventHandler(da_RowUpdating); // Create table and fill with orders schema and data dt = new DataTable(CATEGORIES_TABLE); da.FillSchema(dt, SchemaType.Source);...
Ngày tải lên: 14/12/2013, 18:16
Tài liệu Using a DataView to Control Edits, Deletions, or Additions in Windows Forms pdf
... deleting the data in the control Binding a DataGrid to a DataTable binds to the default view of the underlying DataTable The DataView class represents a view of the DataTable that can be data bound ... whether deletes are allowed AllowEdit Gets or sets a Boolean value indicating whether edits are allowed AllowNew Gets or sets a Boolean value indicating whether new rows can be added If AllowNew is ... System.Data; using System.Data.SqlClient; private DataView dv; // private void ControlDataEditWithDataViewForm_Load(object sender, System.EventArgs e) { // Fill the Order table SqlDataAdapter da...
Ngày tải lên: 14/12/2013, 18:16