directing epidermal fate selection by a novel co culture system pdf

Báo cáo khoa học: High levels of structural disorder in scaffold proteins as exemplified by a novel neuronal protein, CASK-interactive protein1 pot

Báo cáo khoa học: High levels of structural disorder in scaffold proteins as exemplified by a novel neuronal protein, CASK-interactive protein1 pot

... C-terminal Caskin1 are functional and may interact with SH3 domain-containing proteins, such as Abi2 [We have also found an in vivo association and colocalization of Abi2 with Caskin1 (A Balazs, ... of Caskin1 The N-terminal half contains six ankyrin repeats, one SH3 domain and the two SAM domains, whereas the C-terminal half contains no recognizable domain, and has been designated as a proline-rich ... proteolysis [5] At typical protease concentrations at which globular proteins are hardly affected, these proteins are degraded rapidly and completely In accordance with this, PRD-His shows a greater sensitivity...

Ngày tải lên: 16/03/2014, 02:20

13 408 0
Báo cáo khoa học: The activity of Plasmodium falciparum arginase is mediated by a novel inter-monomer salt-bridge between Glu295–Arg404 doc

Báo cáo khoa học: The activity of Plasmodium falciparum arginase is mediated by a novel inter-monomer salt-bridge between Glu295–Arg404 doc

... amidohydrolase [17] Agmatine is formed by decarboxylation of arginine (arginine decarboxylase) and is converted by agmatinase to putrescine and urea Arginase is thus part of one of two alternative biosynthetic ... conformation partially retained The Km value for the Glu295 Ala mutant was not measurable because it was not saturated up to 200 mm arginine Mutating Arg404 to Ala abolished trimer formation However, ... adaptations Mol Biochem Parasitol 128, 21–32 58 Yuvaniyama J, Chitnumsub P, Kamchonwongpaisan S, Vanichtanankul J, Sirawaraporn W, Taylor P, Walkinshaw MD & Yuthavong Y (2003) Insights into antifolate...

Ngày tải lên: 29/03/2014, 23:20

14 426 0
Báo cáo khoa học: Transcription of mammalian cytochrome c oxidase subunit IV-2 is controlled by a novel conserved oxygen responsive element pptx

Báo cáo khoa học: Transcription of mammalian cytochrome c oxidase subunit IV-2 is controlled by a novel conserved oxygen responsive element pptx

... GCTGAAGACCGCGGAGGTAC GAGGTACCCAGAACTGCCCTG GATAGTCAGTGGGGGAAACCTCAG CAGCAAAAGAGGGCTGTGTGGTG TGGCCGCCACGAACATCCCATC GTTGCCCAGGTTGGAGTGCAG CTCGCGGGCTCGGCAGTGGGAG AGTCTATTCTCGAGCACCTGGGACTACAGG AGTCTATTCTCGAGCCCAAAGCGCTGAGATTACAG ... AGTCTATTCTCGAGCCCAAAGCGCTGAGATTACAG AGTCTATTCTCGAGATGCTTCTGGAGTAGGAGGCA AGTCTATTCTCGAGGTGTGGAGGAGGCAGGGAGAC AGTCTATTCTCGAGGAGGCGCTCTGCAGTGCCTC AGTCTATTCTCGAGAAGCAGGACGTTCCCACGCTG AGTCTATTCTCGAGGGGGCGGGCGCCCGCACTCAG ... ATATTCTAGGATCCTGGCTCATTCACTGCTGTCAC ATATTCTAGGATCCCGGCTTCCCCCTCCCTGCAG GCAAATTCTTACTGAGCTTTTACTATATGCACAGC GGACGTTCCCACGCTGGGG GGTCGTAACCACGCTGGGG GGCTGTGGGGCGGGCCGG GGCTGTGGGTATGGCCGG TTCGATCGGGGCGGGGCGA...

Ngày tải lên: 30/03/2014, 03:20

12 333 0
Báo cáo khoa học: Kinetic studies on endo-b-galactosidase by a novel colorimetric assay and synthesis of N -acetyllactosamine-repeating oligosaccharide b-glycosides using its transglycosylation activity pptx

Báo cáo khoa học: Kinetic studies on endo-b-galactosidase by a novel colorimetric assay and synthesis of N -acetyllactosamine-repeating oligosaccharide b-glycosides using its transglycosylation activity pptx

... Proc Natl Acad Sci USA 75, 2315–2319 Yamashita, K., Ohkura, T., Tachibana, Y., Takasaki, S & Kobata, A (1984) Comparative study of the oligosaccharides released from baby hamster kidney cells and ... N-acetyllactosamine-repeating tetrasaccharide b-glycoside (A) and keratan sulfate (B) Arrows show the cleavage site of the glycosidic linkages of each substrate linkages of blood group A and B antigens, Gala1-4Galb14GlcNAc ... (1981) Isolation and characterization of a keratan sulfate-degrading endo-b-galactosidase from Flavobacterium keratolyticus J Biol Chem 256, 3906–3909 Ito, M., Hirabayashi, Y & Yamagata, T (1986)...

Ngày tải lên: 31/03/2014, 07:20

11 365 0
Báo cáo y học: "Familial Polycythemia Caused by a Novel Mutation in the Beta Globin Gene: Essential Role of P50 in Evaluation of Familial Polycythemi" potx

Báo cáo y học: "Familial Polycythemia Caused by a Novel Mutation in the Beta Globin Gene: Essential Role of P50 in Evaluation of Familial Polycythemi" potx

... Giardine B, van Baal S, Kaimakis P, Riemer C, Miller W, Samara M, Kollia P, Anagnou NP, Chui DH, Wajcman H, Hardison RC, Patrinos GP HbVar database of human hemoglobin variants and thalassemia ... Carreno DL, Arrizabalaga B, Atuxta L Hb Johnstown [beta 109 (G11) Val >Leu]: second case described and associated for the first time with beta(0)-thalassemia in two Spanish families Am J Hematol 2000, ... longer easily available in routine and even reference laboratories Lichtman and colleagues have reported a mathematical formula which can be used to calculate P50 reliably [5] Calculating P50 using...

Ngày tải lên: 08/08/2014, 16:23

5 419 0
Báo cáo y học: "α Does protein kinase R mediate TNF-α- and ceramide-induced increases in expression and activation of matrix metalloproteinases in articular cartilage by a novel mechanism" pps

Báo cáo y học: "α Does protein kinase R mediate TNF-α- and ceramide-induced increases in expression and activation of matrix metalloproteinases in articular cartilage by a novel mechanism" pps

... et al versus osteoarthritic cartilage using complementary DNAarray technology Arthritis Rheum 2001, 44:2777-2789 Yoshihara Y, Nakamura H, Obata K, Yamada H, Hayakawa T, Fujikawa K, Okada Y: Matrix ... 344:61-68 Pataer A, Vorburger SA, Barber GN, Chada S, Mhashilkar AM, Zou-Yang H, Stewart AL, Balachandran S, Roth JA, Hunt KK, Swisher SG: Adenoviral transfer of the melanoma differentiation-associated ... cartilage explant cultures was measured by the dimethylmethylene blue (DMMB) assay for sulfated glycosaminoglycan (sGAG), using chondroitin sulfate C from shark cartilage as a standard, as described...

Ngày tải lên: 09/08/2014, 01:23

10 379 0
Báo cáo y học: "Aerosolised surfactant generated by a novel noninvasive apparatus reduced acute lung injury in rats" doc

Báo cáo y học: "Aerosolised surfactant generated by a novel noninvasive apparatus reduced acute lung injury in rats" doc

... evaluated in a rat model with severe ALI induced by oleic acid (OA) Materials and methods Surfactant preparation PPS was isolated from pig bronchoalveolar lavage fluid (BALF) using a protocol ... = severe; = maximal Intra-alveolar oedema was scored as: = absent; = present Statistical analysis SPSS 12.0 statistical software (SPSS Inc, Chicago, IL, USA) was used Data were analysed using ... tracheal instillation of surfactant: a randomized clinical trial Pediatrics 1985, 76:145-153 Furue S, Kuwabara K, Mikawa K, Nishina K, Shiga M, Maekawa N, Ueno M, Chikazawa Y, Ono T, Hori Y, Matsukawa...

Ngày tải lên: 13/08/2014, 15:22

9 306 0
Báo cáo y học: " ISS mapped from ICD-9-CM by a novel freeware versus traditional coding: a comparative study" ppsx

Báo cáo y học: " ISS mapped from ICD-9-CM by a novel freeware versus traditional coding: a comparative study" ppsx

... direct AIS coding by expert registrars Materials and methods We used the database of the Italian Trauma Registry (RITG) and the standard administrative database of hospital discharge records (ADB) ... Cite this article as: Di Bartolomeo et al.: ISS mapped from ICD-9-CM by a novel freeware versus traditional coding: a comparative study Scandinavian Journal of Trauma, Resuscitation and Emergency ... USA than in Italy and other European countries For example, a recent American paper considering all admissions [18] reported an average of 8.6 secondary diagnoses per record, while both an Italian...

Ngày tải lên: 13/08/2014, 23:21

7 209 0
Intravesical tumor necrosis factor alpha gene therapy mediated by a novel liposome system in an orthotopic murine bladder cancer model

Intravesical tumor necrosis factor alpha gene therapy mediated by a novel liposome system in an orthotopic murine bladder cancer model

... primary lymphoma, sarcoma, rhabdomyosarcoma and leiomyosarcoma account for less than 10% of the total cases Seventy to 80% of TCC appears as papillary tumors Papillary tumors are often associated ... is AJCC/UICC (Table 1.1) Traditionally, Ta and T1 papillary urothelial carcinoma are called superficial cancer and T2 and above are termed as muscle invasive cancer Table1.1: Pathological staging ... thanks and deepest appreciation to my supervisors: A/ P Kesavan Esuvaranathan and Dr Ratha Mahendran for their constant guidance, support and encouragement throughout this project and critical...

Ngày tải lên: 08/11/2015, 16:45

121 180 0
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... pernix 277 277 283 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK *****::*.** ... DNA polymerase was purchased from Toyobo (Osaka, Japan) Emulgen 911 was a gift from Kao Chemical (Tokyo, Japan) NADPH, NADH and NADP+ were purchased from Oriental Yeast (Tokyo, Japan) a- Cyano-4-hydroxycinnamic ... :.:: : * : * NAYTAKAVIIAAGVGAFEPRRIGAPGEREFEGRGVYYAVKSKA-EFQGK-RVLIVGGGDS -EYTCDALIIATGASA -RYLGLPSEEAFKGRGVSACATCDG-FFYRNQKVAVIGGGNT LEVKARTVILAVGSRR -RKLGVPGEAELAGRGVSYCSVCDAPLFKGKDAVVVVGGGDS...

Ngày tải lên: 18/02/2014, 08:20

14 617 0
Tài liệu Báo cáo khoa học: Properties of ecdysteroid receptors from diverse insect species in a heterologous cell culture system – a basis for screening novel insecticidal candidates docx

Tài liệu Báo cáo khoa học: Properties of ecdysteroid receptors from diverse insect species in a heterologous cell culture system – a basis for screening novel insecticidal candidates docx

... on the aromatic moiety of dibenzoylhydrazines on larvicidal activity against the Colorado potato beetle Leptinotarsa decemlineata Pest Manag Sci 57, 858–865 Nakagawa Y, Minakuchi C, Takahashi K ... Ogura T, Minakuchi C, Nakagawa Y, Smagghe G & Miyagawa H (2005) Molecular cloning, expression analysis and functional confirmation of ecdysone receptor and ultraspiracle from the Colorado potato ... reagents tested included: MurA (Alexis Biochemical, San Diego, CA, USA), PonA, MakA (AG Scientific, San Diego, CA, USA), and JHIII (Sigma Chemical, St Louis, MO, USA) The diacylhydrazine-based agonists...

Ngày tải lên: 18/02/2014, 08:20

12 628 0
Báo cáo khoa học: The A domain of fibronectin-binding protein B of Staphylococcus aureus contains a novel fibronectin binding site pdf

Báo cáo khoa học: The A domain of fibronectin-binding protein B of Staphylococcus aureus contains a novel fibronectin binding site pdf

... CGGGGATCCGCATCGGAACAAAACAATAC AATCCCGGGTTACTTTAGTTTATCTTTGCCG GGGGGATCCGGTACAGATGTAACAAATAAAG ATTCCCGGGTAATTTTTCCAAGTTAAATTACTTG GGGGGATCCGGTACAGATGTAACAAATAAAG CTCCCCGGGCTATTGAATATTAAATATTTTGCTAA ... CCCGGATCCTATTTAGGTGGAGTTAGAGATAAT AATCCCGGGTTACTTTAGTTTATCTTTGCCG GAATTATCTTTAGCTCTAGCTATTGATCC GGATCAATAGCTAGAGCTAAAGATAATTC GCAGAATTCGTCGGCTTGAAATACGCTG AATGGATCCTTACTTTAGTTTATCTTTGCCG CCCAAGCTTGATGATGTCAGC ... mm sodium acetate at pH 4.5 and immobilized on separate chips at a flow rate of 30 lLÆmin)1 in NaCl ⁄ Pi (Gibco, Carlsbad, CA, USA) Each chip contained a second flow cell, which was uncoated to provide...

Ngày tải lên: 06/03/2014, 00:20

13 515 0
Báo cáo Y học: Restoring enzyme activity in nonfunctional low erucic acid Brassica napus fatty acid elongase 1 by a single amino acid substitution pdf

Báo cáo Y học: Restoring enzyme activity in nonfunctional low erucic acid Brassica napus fatty acid elongase 1 by a single amino acid substitution pdf

... (5¢-TGTTGGTGGGGCCGCTATTTTGCTCT CCAACAAG-3¢) and SDF-4 (5¢-CTTGTTGGAGAGC AAAATAGCGGCCCCACCAACA-3¢) containing the desired mutation (bold) Primers were complementary to opposite strands of pYES2.1/V5-His-TOPO containing ... CUT1 (accession number AF129511) and amino acids 264–323 from A thaliana FAE1 (accession number AF053345), HEA B napus cv.s Golden and Ascari (accession numbers AF00953 and AF274750), HEA B napus ... Alteration of seed fatty acid composition by an ethyl methanesulfonate-induced mutation in Arabidopsis thaliana a ecting diacylglycerol acyltransferase activity Plant Physiol 108, 399–409 Bradford,...

Ngày tải lên: 08/03/2014, 09:20

7 382 0
Báo cáo khoa học: Solution structure of an M-1 conotoxin with a novel disulfide linkage pdf

Báo cáo khoa học: Solution structure of an M-1 conotoxin with a novel disulfide linkage pdf

... IA, Gehrmann J, Loughnan ML, Thomas L, Adams DA, Atkins A, Palant E, Craik DJ, Adams DJ, 2602 Alewood PF et al (2001) Two new classes of conopeptides inhibit the alpha1-adrenoceptor and noradrenaline ... thousand random structures were generated by dyana (v 1.5) that fit the primary sequence and covalent and spatial requirements of mr3e A total of 190 distance constraints, six u angle restraints and ... 2177–2183 Al-Sabi A, Lennartz D, Ferber M, Gulyas J, Rivier JE, Olivera BM, Carlomagno T & Terlau H (2004) Kappa M-conotoxin RIIIK, structural and functional novelty in a K+ channel antagonist...

Ngày tải lên: 30/03/2014, 09:20

7 346 0
Báo cáo sinh học: " Inhibition of phosphorylated c-Met in rhabdomyosarcoma cell lines by a small molecule inhibitor SU11274" pdf

Báo cáo sinh học: " Inhibition of phosphorylated c-Met in rhabdomyosarcoma cell lines by a small molecule inhibitor SU11274" pdf

... 24:816-822 Andrade CR, Takahama Junior A, Nishimoto IN, Kowalski LP, Lopes MA: Rhabdomyosarcoma of the head and neck: a clinicopathological and immunohistochemical analysis of 29 cases Braz Dent ... Seiwert TY, Jagadeeswaran R, Faoro L, Janamanchi V, Nallasura V, El Dinali M, Yala S, Kanteti R, Cohen EE, Lingen MW, et al: The MET receptor tyrosine kinase is a potential novel therapeutic target ... embryonal rhabdomyosarcoma; ARMS: alveolar rhabdomyosarcoma; RTK: receptor tyrosine kinases; HGF/SF: hephotocyte growth factor/scatter factor; mTOR: mammalian target of rapamycin; DMEM: Dulbecco’s Modified...

Ngày tải lên: 18/06/2014, 19:20

10 402 0
báo cáo hóa học: " Reduced inclination of cervical spine in a novel notebook screen system - implications for rehabilitation" docx

báo cáo hóa học: " Reduced inclination of cervical spine in a novel notebook screen system - implications for rehabilitation" docx

... performed the analysis and interpretation of the data MFS, SU, KV, SM, BK: Participation in the analysis of data, revision of the manuscript All authors read and approved the final manuscript Received: ... musculoskeletal disease a global perspective Clinical rheumatology 2006, 25:778-781 Kambin P, Abda S, Kurpicki F: Intradiskal pressure and volume recording: evaluation of normal and abnormal cervical disks ... to changes in the intradiscal pressure (PID) It has been suggested that an increased PID may worsen the alimentary status of the intravertebral disc that might contribute to a faster advancing...

Ngày tải lên: 20/06/2014, 00:20

6 536 0
báo cáo hóa học:" Inhibition of phosphorylated c-Met in rhabdomyosarcoma cell lines by a small molecule inhibitor SU11274" pdf

báo cáo hóa học:" Inhibition of phosphorylated c-Met in rhabdomyosarcoma cell lines by a small molecule inhibitor SU11274" pdf

... 24:816-822 Andrade CR, Takahama Junior A, Nishimoto IN, Kowalski LP, Lopes MA: Rhabdomyosarcoma of the head and neck: a clinicopathological and immunohistochemical analysis of 29 cases Braz Dent ... Seiwert TY, Jagadeeswaran R, Faoro L, Janamanchi V, Nallasura V, El Dinali M, Yala S, Kanteti R, Cohen EE, Lingen MW, et al: The MET receptor tyrosine kinase is a potential novel therapeutic target ... embryonal rhabdomyosarcoma; ARMS: alveolar rhabdomyosarcoma; RTK: receptor tyrosine kinases; HGF/SF: hephotocyte growth factor/scatter factor; mTOR: mammalian target of rapamycin; DMEM: Dulbecco’s Modified...

Ngày tải lên: 20/06/2014, 03:20

10 373 0
Báo cáo toán học: " Synthesis and characterization of CuO nanowires by a simple wet chemical method" pdf

Báo cáo toán học: " Synthesis and characterization of CuO nanowires by a simple wet chemical method" pdf

... dispersed CuO phases towards nitrogen oxides (N2O, NO, and NO2) Appl Catal B 2006, 62:336-344 12 Ghosh S, Avasthi DK, Shah P, Ganesan V, Gupta A, Sarangi D, Bhattacharya R, Assmann W: Deposition of ... Deng JF: A convenient alcohothermal approach for low temperature synthesis of CuO nanoparticles Mater Lett 2002, 52:34-38 32 Zarate RA, Hevia F, Fuentes S, Fuenzalida VM, Zuniga A: Novel route ... Synthesis and characterization of CuO nanowires by a simple wet chemical method Anita Sagadevan Ethiraj1 and Dae Joon Kang*1 BK21 Physics Research Division, Department of Energy Science,...

Ngày tải lên: 20/06/2014, 21:20

12 639 0
Báo cáo y học: " Curcumin mediated suppression of nuclear factor-κB promotes chondrogenic differentiation of mesenchymal stem cells in a high-density co-culture microenvironment" pdf

Báo cáo y học: " Curcumin mediated suppression of nuclear factor-κB promotes chondrogenic differentiation of mesenchymal stem cells in a high-density co-culture microenvironment" pdf

... promote cartilage degradation and stimulate further joint inflammation (4) and a self-perpetuating inflammatory and catabolic cascade develops As illustrated, cartilage contains chondrocytes and MSC-like ... where cartilage damage is marginal Abbreviations AP30 3a: alkaline phosphatase linked sheep anti-mouse; AP30 4A: sheep antirabbit secondary antibodies; DMSO: dimethylsulfoxide; COX-2: cyclooxygenase-2; ... cascade by IL-1β in MSCs, cultures were evaluated for activated caspase-3 and the marker of inflammation and prostaglandin production COX-2 (Figure 3D) Production of activated caspase-3 and COX-2...

Ngày tải lên: 12/08/2014, 14:22

15 328 0
Báo cáo y học: "HIV-1 subtype distribution in the Gambia and the significant presence of CRF49_cpx, a novel circulating recombinant form" pdf

Báo cáo y học: "HIV-1 subtype distribution in the Gambia and the significant presence of CRF49_cpx, a novel circulating recombinant form" pdf

... CAAGCATGKGTAGCCCAGAYATTATG MO188 p24 to env IF 2034 - 2060 ATGTGGGAARGARGGACACCAAATGAA MO189 p24 to env IR 6335 - 6360 TCCACACAGGTACCCCATAATAGACT MO191 5’ LTR to gag p24 OR 832 - 859 AATGCTGWRAACATGGGTATTACTTCTG ... MO042 gag p24 OF-1 890-909 TAGTATGGGCAAGCAGGGAG MO024 gag p24 OF-2 508 - 527 AACCCACTGCTTAAGCCTCA MO044 gag p24 OR 2272-2252 TGCCAAAGAGTGATTTGAGGG MO043 gag p24 IF 1048-1067 TGYGTRCATCAAARGATAGA MO045 ... 2846 - 2871 TTCTGTATRTCATTGACAGTCCAGCT AJB-4F p24 to env sequencing 2741 - 2765 ACACCAGAYAARAARCATCAGAAAG AJB-5R p24 to env sequencing 3585 - 3610 GATTCCTAATGCATACTGTGAGTCTG AJB-6F p24 to env sequencing...

Ngày tải lên: 13/08/2014, 01:20

14 334 0
w