delivering great customer service through a team

Marketing - Chapter 2: Delivering customer service

Marketing - Chapter 2: Delivering customer service

Ngày tải lên : 23/10/2013, 20:15
... nay responses that need to be made in a diary or electronic calendar, along with accurate client contact detail. When the response will take some time, send a fax or email assuring the customer ... building a relationship of mutual harmony and understanding. ã If you establish rapport with a person, you build a climate of trust and respect. Having rapport does not mean that you have agree, ... you will be aware of the benchmark for quality customer service. You may have your performance evaluated against those criteria 2.5.Promoting products and services ã Therere many way in which...
  • 26
  • 541
  • 1
Providing Superior Customer Service

Providing Superior Customer Service

Ngày tải lên : 18/10/2012, 16:06
... It's just as easy to make a call to your local library and fax the information to your client as it is to say "I don't know anything about that." And making that extra effort ... requests that are too outrageous to comply with. If that's the case, do your best to offer a moderate, appealing alternative. 2) Feedback Keeps You Focused Ask your customers to rate your service ... Superior Customer Service You can use customer service as a powerful way to set yourself apart from your competition. Its one of the strengths a small business has, and by emphasizing customer service, ...
  • 4
  • 363
  • 2
Some aspects of American culture and society in the twentieth and twenty-first centuries through a number of selected short literary works

Some aspects of American culture and society in the twentieth and twenty-first centuries through a number of selected short literary works

Ngày tải lên : 07/11/2012, 15:01
... industry. Within the American society, there are many races such as white, black or African-American, American Indian or Alaska native, Asian, native Hawaiian, other Pacific Islander and ethnic groups ... part-time at a bookstore; Sang’s boyfriend, Farouk, an Egyptian American who was teaching Middle Eastern history at Harvard; Heather, the housemate of Sang and Paul, who was a law student at Boston ... which we usually have with our American teachers in particular and with our American friends in general. II.2.2. Racial discrimination Racial discrimination is as old as American history since...
  • 49
  • 785
  • 1
Customer Service - Principles of Service Marketing and Management - C Lovelock & L Wright

Customer Service - Principles of Service Marketing and Management - C Lovelock & L Wright

Ngày tải lên : 07/02/2013, 09:52
... rowers, made famous by the Oxford and Cambridge boat race that has taken place annually on the River Thames near London for almost 150 years. Today, similar races involving many different teams are ... traveling abroad. More and more services are being delivered through national or global chains. Brand names such as Air Canada, Burger King, Body Shop, Hertz, Kinko's, and Mandarin Hotels have ... customers greater convenience. Balancing Demand and Capacity In general, services that process people and physical objects are more likely to face capacity limitations than those that are information...
  • 387
  • 1.2K
  • 6
CUSTOMER SERVICE RECOMMENDATIONS TO INCREASE SALES FOR KICHI-KICHI HOTPOT BAR ON 61 MA MAY STREET, HA NOI

CUSTOMER SERVICE RECOMMENDATIONS TO INCREASE SALES FOR KICHI-KICHI HOTPOT BAR ON 61 MA MAY STREET, HA NOI

Ngày tải lên : 15/04/2013, 13:51
... improved. Secondary data: All the data about each restaurant turnover and result of promotion programs are provided by Marketing and Accounting Department from Golden Gate Trade & Service JSC. ... that perspective, customer service should be included as part of an overall approach to systematic improvement. Customer service plays an important part in keeping existing and making loyal customer, ... Minh City, Hanoi and other potential cities in Vietnam: Danang, Cantho, Nhatrang, etc. at the age from 20 to 40. Company aims at administrative staff circle - accounts for about 20% population, mostly...
  • 46
  • 845
  • 8
customer service

customer service

Ngày tải lên : 27/10/2013, 12:15
... the sales must lead the negotiations. Afterwards the complaint with the final creation of the complaint handling can be locked. The entire statistical allocation of the complaint data and ... load (so far possible), detailed inquiry. Accommodation of the complaint Apart from the input into the data base also the immediate measures stated in the form are to be initiated so far ... S11 Customer Service Issued by Date of Release Version Page Ing. Mathe 00 4/4 Receipt At least following data are to be determined by the customer: Customer, partner, article,...
  • 4
  • 433
  • 0
Tài liệu Customer Relationship Management: A Database Approach - Class 6 pptx

Tài liệu Customer Relationship Management: A Database Approach - Class 6 pptx

Ngày tải lên : 22/12/2013, 14:16
... causally tied to churn and abandonment, making this trickier than it looks. 6. You need to understand NPV calculations. ã Computation of Customer Profitability ã Past Customer Value of a customer Where ... Customer Relationship Management: A Database Approach MARK 7397 Spring 2007 James D. Hess C.T. Bauer Professor of Marketing Science 375H Melcher Hall jhess@uh.edu 713 743-4175 Class 6 ... the customer has abandoned the firm no profits will flow.) 4. It is possible that customers will “churn.” That is, they may leave and then return later. 5. The contribution of a customer may...
  • 20
  • 370
  • 0
Tài liệu Customer Relationship Management - A Databased Approach docx

Tài liệu Customer Relationship Management - A Databased Approach docx

Ngày tải lên : 22/12/2013, 14:16
... on an average transaction ã Tracks customer behavior over time in a state-space www.drvkumar.com Copyright Dr. V. Kumar, 2005 ã Aggregate Share-of-Wallet (ASW) (brand or firm level) – Aggregate ... it has been since a customer last placed an order with the company ã Frequency-how often a customer orders from the company in a certain defined period ã Monetary value- the amount that a customer ... source: Numerator: From internal records Denominator: Through market and distribution panels, or primary market research (surveys) and extrapolated to the entire buyer Evaluation: Important measure of customer...
  • 61
  • 505
  • 0
Tài liệu Chăm sóc khách hàng ( Customer Service ) doc

Tài liệu Chăm sóc khách hàng ( Customer Service ) doc

Ngày tải lên : 17/01/2014, 03:20
... effective service standards. 14 Name some of the criteria that may be included in a citizen satisfaction survey. 15 What are some of the ways to measure customer/ user satisfaction? 16 What steps can ... take to establish a " ;customer first" attitude in the organization? 17 In what ways can an organization transfer a " ;customer first" attitude to the Internet? 18 Tell us about ... Fax: 04. 7855518 - Website: www.cpoclub.net - Email: contact@cpoclub.net company's trucks ran over her mailbox. How will you handle the citizen? 13 Name five criteria essential to establishing...
  • 2
  • 1K
  • 3
Tài liệu Using a Web Service as a Data Source pdf

Tài liệu Using a Web Service as a Data Source pdf

Ngày tải lên : 21/01/2014, 11:20
... Details]", ConfigurationSettings.AppSettings["DataConnectString"]); DataTable orderDetailTable = new DataTable(ORDERDETAILS_TABLE); da.FillSchema(orderDetailTable, SchemaType.Source); ... da.FillSchema(orderTable, SchemaType.Source); da.Fill(orderTable); ds.Tables.Add(orderTable); // Fill the OrderDetails table and add it to the DataSet. da = new SqlDataAdapter("SELECT ... "Order_OrderDetails_Relation"; // . . . [WebMethod] public DataSet LoadOrders( ) { DataSet ds = new DataSet( ); SqlDataAdapter da; // Fill the Order table and add it to the DataSet....
  • 4
  • 369
  • 0
Tài liệu Báo cáo khoa học: C-Terminal extension of a plant cysteine protease modulates proteolytic activity through a partial inhibitory mechanism doc

Tài liệu Báo cáo khoa học: C-Terminal extension of a plant cysteine protease modulates proteolytic activity through a partial inhibitory mechanism doc

Ngày tải lên : 14/02/2014, 14:20
... aa 208 aa 24 aa BamH 34 aa Start Stop Xho1 N -Pro Protease domain Protease domain CT - ex 380 aa 1 II NP 114 aa 208 aa BamH1 34 aa Start Stop Xho1 SS SS G SSS S N-Pro 356 aa III MSTLFII S ILLFLAS F SYAMDI S TIEYKYDKSS AWRTDEEVKEIYELWLAKHDKVY SG LVEYEKRFEIFKDNLKFIDEH NSENHTYKMGLTPYTDLTNEEFQAIYLGTRSDTIHRLKRTINISERYAYEAGDNLPEQIDWRKKGAVTPVKNQGKCG SCWAFSTVSTVESINQIRTGNLISLSEQQLVDCNKKNHG CKGGAFVYAYQYIIDNGGIDTEANYPYKAVQGPCRAAK KVVRIDGYKGVPHCNENALKKAVASQPSVVAIDASSKQF QHYKSGIFSGPCGTKLNHGVVIVGYWKDYWIVRNSW GRYWGEQGYIRMKRVGGCGLCGIARLPYYPTKA AGDENSKLETPELLQWSEEAFPLA IV A B 66 ... of a plant cysteine protease modulates proteolytic activity through a partial inhibitory mechanism Sruti Dutta, Debi Choudhury, Jiban K. Dattagupta and Sampa Biswas Crystallography and Molecular ... protease from the latex of Ervatamia coronaria. Biosci Biotechnol Biochem 62, 1947–1955. 15 GuhaThakurta P, Biswas S, Chakrabarti C, Sundd M, Jagannadham MV & Dattagupta JK (2004) Structural basis...
  • 13
  • 759
  • 0