... in the Cisco Network Academy Program Best Practices Challenges Description: Challenges are problem-based labs or projects, advocated by AAAS Project 206 1 (a ... following two LAN technologies for use in a high school environment on a limited budget: 10BASE-T Ethernet and 100 BASE-TX Fast Ethernet (Sem 1 and Sem 3). • Compare the following two WAN technologies ... of connections to other content. For networking students, a presentation provides experience in explaining a design, a project, or a solution. As a networking associate, this practice will...
Ngày tải lên: 18/01/2014, 04:20
... into Networks • Reasons for grouping devices into sub-networks and define several terms used to identify the sub-networks – Geographic Học viện mạng Bách khoa - Website: www.bkacad.com 27 Network ... destination within a network or on another network with minimum overhead. • Reasons for grouping devices into sub-networks and define several terms used to identify the sub-networks – Ownership Grouping ... www.bkacad.com 39 Network Layer Protocols and Internet Protocol (IP) Học viện mạng Bách khoa - Website: www.bkacad.com 3 • Define the basic role of the Network Layer in data networks • The protocols...
Ngày tải lên: 22/12/2013, 13:17
CCNA 1 and 2 Companion Guide, Revised (Cisco Networking Academy Program) part 5 pps
Ngày tải lên: 04/07/2014, 18:20
Cisco Secure PIX Firewall Advanced Version 4.0
... deny 0 0 eq jave pix(config)#apply (inside) 1 outgoing_src B. pix(config)#outbound 1 deny 0. 0 .0. 0 0. 0 .0. 0 java pix(config)#apply (inside) 1 outgoing_src C. pix(config)#outbound 1 deny 0. 0 .0. 0 ... King(config)#interface ethernet4 100 full King(config)#ip address tess 172.19.4.1 255 . 255 . 255 .0 QUESTION NO: 100 Type the command that reboots the PIX Firewall. Answer: reload 9E0 - 111 Leading ... NO: 30 What is the command to enable a PIX Firewall to inspect port 55 4 for RTSP traffic? A. fixup protocol rtsp 55 4 B. inspect rtsp 55 4 C. fixup rtsp 55 4 D. inspect protocol rtsp 55 4 ...
Ngày tải lên: 18/10/2013, 18:15
Cisco Secure PIX Firewall Advanced Version 7.0
... Reference: Cisco PIX 50 0 Series Firewalls - Cisco PIX Firewall Software v5.2 http://www .cisco. com/en/US/products/hw/vpndevc/ps 203 0/products_data_sheet09186a 00 800 91b32.html QUESTION NO: 35 Why ... time. Reference: Cisco PIX 50 0 Series Firewalls - PIX 53 5 http://www .cisco. com/en/US/products/hw/vpndevc/ps 203 0/products_installation_guide_c hapter09186a 008 017279e.html 9E0 - 111 Leading ... deny 0 0 eq jave pix(config)#apply (inside) 1 outgoing_src B. pix(config)#outbound 1 deny 0. 0 .0. 0 0. 0 .0. 0 java pix(config)#apply (inside) 1 outgoing_src C. pix(config)#outbound 1 deny 0. 0 .0. 0...
Ngày tải lên: 22/10/2013, 16:15
CCIE Pre-Qualification Test for Security Version 5.0
... router ospf 1 network 108 .3. 100 .0 0 .0. 0. 255 area 6 network 108 .3.2 .0 0 .0. 0. 255 area 0 D. router ospf 1 network 108 .3. 100 .0 255 . 255 . 255 .0 area 6 network 108 .3.2 .0 255 . 255 . 255 .0 area 6 E. router ... router ospf 1 network 108 .3.1 .0 0 .0. 0. 255 area 6 network 108 .3. 100 .0 0 .0. 0. 255 area 6 network 108 .3.2 .0 0 .0. 0. 255 area 6 Answer: D Explanation: Networks 108 .3. 100 .0 and 108 .3.2 .0 using a ... 101 permit ip 20. 1.1 .0 0 .0. 0. 255 30. 1.1 .0 0 .0. 0. 255 access-list 101 permit ip 20. 1.1 .0 0 .0. 0. 255 40. 1.1 .0 0 .0. 0. 255 D. crypto map foo 10 ipsec-isakmp set peer B match address 101 set trans...
Ngày tải lên: 26/10/2013, 23:15
Tài liệu Developing XML Web Services and Server Components with Microsoft Visual Basic .NET MCSD/MCAD/MCDBA Version 5.0 pptx
... Which version of the remote objects will MyApp activate? A. version 1 .0. 0 .0 of TK1; version 1 .0. 0 .0 of TK2 B. version 1 .0. 0 .0 of TK1; version 2 .0. 0 .0 of TK2 C. version 2 .0. 0 .0 of TK1; version ... TK2 C. version 2 .0. 0 .0 of TK1; version 1 .0. 0 .0 of TK2 D. version 2 .0. 0 .0 of TK1; version 2 .0. 0 .0 of TK2 Answer: B Explanation: Version 1 .0. 0 .0 of TK1 is used since the following client-activated ... Size property of the connectionString to 50 . All 50 connections are now in use. However, a request for connection number 51 is received. 07 0 - 3 10 Leading the way in IT testing and...
Ngày tải lên: 10/12/2013, 14:16
Tài liệu Cisco Network Administration Certification Guide_ CNA 5 ppt
... YROXPH7KHDWWULEXWHWRNHHSILOHVIURPEHLQJPLJUDWHGLV&apos ;0 ±'RQ¶W 0LJUDWH 0$ 3FRPPDQGRSWLRQV 0$ 3 'LVSOD\VDOLVWRIFXUUHQWGULYHPDSSLQJV 0$ 3 ; 6 (59 (5 ?6<6 0DSVWKH;GULYHWRWKH6<6YROXPHRQ6 (59 (5 FUHDWHVDQ$;7ILOH±$SSOLFDWLRQ2EMHFW7H[W7HPSODWH7KH$27LVLQELQDU\ IRUPDWDQGFDQQRWEHHGLWHG7KH$;7FDQEHHGLWHG7KLV$27FDQEH FRQILJXUHGLQDQ$SSOLFDWLRQREMHFWDQGUROOHGRXWWRZRUNVWDWLRQVZKHUHWKH DSSOLFDWLRQZLOOEHLQVWDOOHG,WDOVRKDVDYHULILFDWLRQSURFHVVVRWKDWLIDILOH DVVRFLDWHGZLWKWKHDSSOLFDWLRQEHFRPHVGHOHWHGRUFRUUXSWLWZLOOUHLQVWDOOWKH $27 ... XVHUVDVSHFW 7KH7UXVWHHVRIWKLV'LUHFWRU\SDJHLVXVHGWRDVVLJQULJKWVIURPD GLUHFWRU\VDVSHFW 0$ 316 (59 (5 ?6<6 0DSVWKHQH[WDYDLODEOHGULYHWRWKH6<6YROXPHRQ6 (59 (5 0$ 3 '(/; 'HOHWHVWKHGULYHPDSSLQJWR; 0$ 3 6 6<66<67 (0 0DNHVWKH6<66<67 (0 GLUHFWRU\WKHVHFRQGVHDUFKGULYH 0$ 3 ... LPSRUWZRUNVWDWLRQVLQWRWKH1'6DQGWRPDQDJHDQGPDLQWDLQ QHWZRUNDSSOLFDWLRQV &RPPDQGVDQG,GHQWLILHUV /RJLQVFULSWVKDYHWZRFRPSRQHQWVFRPPDQGVDQGLGHQWLILHUYDULDEOHV &RPPDQGV 0$ 3 &UHDWHVGULYHOHWWHUVWRSRLQWWRGLUHFWRULHVLQWKHILOHV\VWHP 5( 0 5( 0 $5. &RPPHQWLQJRXWDOLQH±WKHORJLQVFULSWLJQRUHVDQ\WKLQJ DIWHUDUHPDUN ([DPSOH 5( 0 0$ 3)...
Ngày tải lên: 10/12/2013, 16:15
Tài liệu TestKing''''s Designing Cisco Network Service Architectures Exam Version 4.1 doc
... A. 2 50 0 B. 300 0 C. 50 00 D. 6 50 0 Answer: C QUESTION NO: 65 Which of the following is a web-browser based tool designed to provide administrative access for content networking? ... discovery. B. Set the MTU higher than 1 50 0 bytes. C. Turn off pre-fragmentation for IPSec. D. Set the MTU value to 1 400 bytes. Answer: C, D QUESTION NO: 50 642 - 871 Leading the way ... than 200 meters apart. All campus wiring is Category 5e 642 - 871 Leading the way in IT testing and certification tools, www.testking.com - 25 - A. Netsys B. CiscoAssure C. CiscoWorks...
Ngày tải lên: 10/12/2013, 16:15
Tài liệu Cisco Network Academy Program_ Practices docx
... following IOS statement so that it assigns 193.1.7 .5 as the static route for all packets on 199.4 .5. 0: ip route 193.1.7 .5 255 . 255 . 255 .0 199.4 .5. 0 (Sem2) Level 4 Analysis Analysis allows students ... You are troubleshooting the 5- router network. Distinguish between observable network symptoms and what problems you might infer are causing those symptoms. Level 5 Synthesis Synthesis allows ... Best Practices* Ideas to help you when implementing Best Practices in the Cisco Network Academy Program These rubrics provide a standard for learners. It...
Ngày tải lên: 21/12/2013, 05:16
Tài liệu Cisco Networking Academy Program: Engineering Journal and Workbook, Volume II, Second Edition ppt
... Access-list 101 permit tcp 10. 1.1 .0 0 .0. 0. 255 [student LAN] host 10. 1.2.13 [Mail server on Admin LAN] eq 25 (Outgoing mail – SMTP) Access-list 101 permit tcp 10. 1.1 .0 0 .0. 0. 255 [student LAN] host 10. 1.2.13 ... 64 ,51 2– 65, 5 35. ) 3. What is the router command sequence needed to implement IGRP on the school’s router? RouterName(Config)# router IGRP 6 455 0 RouterName(Config-Router) #network 10. 0 .0. 0 RouterName(Config-Router) #network ... collision domain and accesses the full 10, 100 , or 100 0 Mbps. 10 Mbps is usually referred to as Ethernet, 100 Mbps is called Fast Ethernet, and 100 0 Mbps is labeled Gigabit Ethernet. • Symmetric...
Ngày tải lên: 21/12/2013, 05:18
Tài liệu Cisco Networking Academy Program: Engineering Journal and Workbook, Volume I, Second Edition ppt
... IEEE 802 .3 specification include 10BASE2, 10BASE5, 10BASE-F, 10BASE-T, and 10Broad36. Physical variations for Fast Ethernet include 100 BASE-T, 100 BASE-T4, and 100 BASE-X. LAN (local-area network) ... EISA, and so on) • Network topology (bus, ring, star) • Medium type (UTP, STP, 10Base2, 10Base5, 10BaseF) • Transport speed (1 Mbps, 4 Mbps, 10 Mbps, 16 Mbps, 100 Mbps, 100 0 Mbps) ⇒ Set the ... Engineering Journal and Workbook, Vol. I, 2 nd Ed. – Chapter 1 Copyright © 200 2 Cisco Systems, Inc. Cisco Networking Academy Program: Engineering Journal and Workbook, Volume I, Second Edition Engineering...
Ngày tải lên: 17/01/2014, 08:20
Tài liệu Cisco Secure Intrusion Detection Systems - Version 6.0 doc
... that communicates on UDP ports 600 0- 700 0. Which Cisco IDS signature micro-engine can be used to detect attempts to locate the servers? A. Atomic.IPOptions 9E0- 100 46 21certify.com A. ... Reference: Cisco Secure PIX Firewall (Ciscopress) page 89 21certify.com CISCO: Cisco Secure Intrusion Detection Systems (CSIDS) 9E0- 100 Version 6 .0 Jun. ... (Ciscopress) page 6 80 Q.28 Which Cisco IDS software update file can be installed on a IDS-42 10 Sensor? A. IDSMk9-sp-3 .0- 3-S 10. exe B. IDSMk9-sp-3 .0- 3-S 10. bin C. IDSMk9-sig-3 .0- 3-S 10. exe D. IDSk9-sp-3.1-2-S24.exe...
Ngày tải lên: 17/01/2014, 14:20
Tài liệu Cisco Networking Academy Program docx
... Access Server 2 50 0 See Cisco 2 50 0. Cisco Access Server 51 00 See Cisco 51 00 . ciscoBus controller See SP. Cisco Discovery Protocol See CDP. Cisco Extended Bus See CxBus. Cisco FRAD Cisco Frame ... 1-4 v 3 .0 – Glossary Copyright 200 3, Cisco Systems, Inc. Cisco 7 50 0 Any of the Cisco 7 50 0 series of routers, a high-end multiprotocol router platform designed for use in enterprise networks. ... DS-1 applications with 24 trunks. C - 30 CCNA 1-4 v 3 .0 – Glossary Copyright 200 3, Cisco Systems, Inc. Cisco LightStream 202 0 Cisco LightStream 202 0 Enterprise ATM switch. For campus and...
Ngày tải lên: 18/01/2014, 04:20
Tài liệu Cisco Secure PIX Firewall Advanced - Version 4.0 pptx
... deny 0 0 eq jave pix(config)#apply (inside) 1 outgoing_src B. pix(config)#outbound 1 deny 0. 0 .0. 0 0. 0 .0. 0 java pix(config)#apply (inside) 1 outgoing_src C. pix(config)#outbound 1 deny 0. 0 .0. 0 ... King(config)#interface ethernet4 100 full King(config)#ip address tess 172.19.4.1 255 . 255 . 255 .0 QUESTION NO: 100 Type the command that reboots the PIX Firewall. Answer: reload 9E0 - 111 Leading ... 0. 0 .0. 0 255 . 255 . 255 . 255 java pix(config)#apply (inside) 1 outgoing_src D. pix(config)#outbound 1 deny java pix(config)#apply (inside) 1 outgoing_src Answer: B QUESTION NO: 76 Network...
Ngày tải lên: 24/01/2014, 10:20
Mobile Advertising Guidelines Version 5.0 Mobile Marketing Association docx
Ngày tải lên: 15/03/2014, 22:20
CCNA 1 and 2 Companion Guide, Revised (Cisco Networking Academy Program) part 110 ppt
Ngày tải lên: 04/07/2014, 18:20
CCNA 1 and 2 Companion Guide, Revised (Cisco Networking Academy Program) part 1 doc
Ngày tải lên: 04/07/2014, 18:20
CCNA 1 and 2 Companion Guide, Revised (Cisco Networking Academy Program) part 2 pptx
Ngày tải lên: 04/07/2014, 18:20
Bạn có muốn tìm thêm với từ khóa: