... theoretical contributions useful and a source of competitive advantage Many of these players may honestly and eagerly believe that markets are mathematically tamable and that quantitative measures can ... world-class professors and doctorate students (NYU is a consistent global leader in financial economics education and research), the revered mathematician loudly stated that he does not hire Finance academics ... flaws, how and why it can drastically move markets, what the resultant implied volatility parameter truly stands for The meat of Haug and Taleb s newer complaints is more a matter of semantics...
Ngày tải lên: 01/11/2014, 21:46
... phrase, and a participle phrase 13 a contraction, an adverb, and a prepositional phrase 14 a gerund phrase, a prepositional phrase, an adverb, and an adjective 15 an adverb, a prepositional phrase, ... an adjective, a compound subject, and a prepositional phrase 10 a prepositional phrase that starts the sentence 11 an adjective phrase and an infinitive phrase 12 a question mark, an adverb, an ... cook, and is very good at it (B) Brenda loves to cook and she is very good at it (C) Brenda, who likes to cook, serves delicious dishes (A) Andre Agassi, the tennis player and new father is a friendly...
Ngày tải lên: 25/10/2013, 17:20
Tài liệu THIS DISPOSTION IS NOT CITABLE AS PRECEDENT OF THE T.T.A.B04/3/02 Paper No. 12 RFC docx
... publications She argued that this evidence establishes that the goods are related The first article indicates that skin toner, cologne and skin cream contain vitamins The second article contains ... cream, skin toners and astringents and skin cleansers, and the goods specified in the cited registration, “herbal concentrates for dietary supplement” and “vitamin supplements of herbal or organic ... points out, in any likelihood of confusion analysis, two key considerations are the similarities of the goods and the similarities of the marks Tricia Guild Associates Ltd v Crystal Clear Ser No 75/934,127...
Ngày tải lên: 20/12/2013, 23:15
Tài liệu 11) The reader is not your friend pdf
... graphics have several advantages About author Hans Anderson 2007-Present: Lecturer at FPT Greenwich Programmes, FPT University 2007: M .S. , Computational Mathematics, University of Minnesota ... is also not ok to talk about the reader In an academic paper, the reader is not your friend so don’t be too friendly Don't talk about yourself Instead of: Google Sites is my favorite way to make ... make a free website Write: Google Sites is one of the most popular free website design solutions (PC magazine) Don't talk about yourself Instead of: I found many examples of web 2.0 techniques on...
Ngày tải lên: 20/01/2014, 06:20
Tài liệu Báo cáo khoa học: Bacitracin is not a specific inhibitor of protein disulfide isomerase pptx
... A. -R Karala and L W Ruddock bacitracin contains at least nine different peptides, of which bacitracin A is the most abundant, and it is mainly used as an antibiotic against infections caused ... presented as mean ± standard deviation (number of samples) Statistical significance between each pair of samples with and without bacitracin present was determined using Student s t-test (two-tailed, ... B-chain of insulin causes precipitation that can be followed as an absorbance increase at 540 nm (A) Representative changes in absorbance as a function of time From left to right, the traces are:...
Ngày tải lên: 16/02/2014, 14:20
Tài liệu The Internal Revenue Service Is Not Adequately Protecting Taxpayer Data on Laptop Computers and Other Portable Electronic Media Devices docx
... readable data Campuses are the data processing arm of the IRS The campuses process paper and electronic submissions, correct errors, and forward data to the Computing Centers for analysis and ... Mission Assurance and Security Services organization has requested a quantification of the impact to taxpayers and a determination of the lost data In addition, the CSIRC made modifications to ... mission, objectives, and business vision A flash drive is an external data storage device that plugs into the computer and emulates a small disk drive It allows data to be easily transferred from...
Ngày tải lên: 18/02/2014, 04:20
Hematopoiesis is not clonal in healthy elderly women pptx
... coat patterns and behavioral characteristics indicate that the environment plays a significant role in establishing these traits.37 Changes in DNA methylation at CpG islands, which may be associated ... observe skewed or clonal hematopoiesis in any of these same individuals using our novel quantitative transcriptional clonality assay Formal statistical analysis, using an exact binomial test, ... represents the A ϭ 1Ϫ [ (A / (A A )) (A Ј/ (A Ј A Ј)) ( (A / (A A )) (A / (A A )) ϩ (A Ј/ (A Ј A Ј)) (A Ј/ (A Ј A Ј)) ) ] Statistical analysis1 The data for the analysis were arranged by pairing...
Ngày tải lên: 05/03/2014, 21:20
Báo cáo khoa học: Heterologous synthesis of cytochrome c¢ by Escherichia coli is not dependent on the System I cytochrome c biogenesis machinery ppt
... mkhvlastaaglmalgl-assaiaAGLSPEEQIETRQAG mkklstlaalacmtvgsll-atsaqaQFAKPEDAVKYRQSA mrrvllatlmaalpaaaMAADAEHVVEARKGY 40 50 60 70 YTTMAWNMGKIKAMVVDGTMPFSQTQVSAAANVIAAIANSGMGALYSPDTLGVVGFKKSR * ** ... LKENFFQEQDEVRKIATNFVEQANKLAEVAAMGDKDEIKAQFGEVGKACKACHEKFREEE * * * * VKPEFFQNMEDVGKIAREFVGAANTLAEVAATGEAEAVKTAFGDVGAACKSCHEKYRAKARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKKK AKAAIWQDADGFQAKGMAFFEAVAALEPAAGAGQKE-LAAAVGKVGGTCKSCHDDFRVKR ... isomerization Proc Natl Acad Sci USA 93, 13048–13053 28 Oikawa K, Nakamura S, Sonoyama T, Ohshima A, Kobayashi Y, Takayama SJ, Yamamoto Y, Uchiyama S, Hasegawa J & Sambongi Y (2005) Five amino acid...
Ngày tải lên: 06/03/2014, 00:20
''''This Is Not a Game'''': Immersive Aesthetics and Collective Play pdf
... disappointment at this announcement evaporated, however, when phone calls and instant messages from an anonymous source began claiming that the Majestic fire was arson and part of a larger and dangerous conspiracy ... the answers IS the narrative that has me hooked… a meta-narrative" [20] In another editorial "Meta Mystery," Maria Bonasia, a twentysomething Massachusetts-based playwright, discussed "the possibility ... tracking and interpreting plot developments and evidence that circulated mostly through Web sites and emails, but also through phone calls, faxes, television and newspaper ads, as well as occasional...
Ngày tải lên: 07/03/2014, 17:20
Báo cáo Y học: Regulation of RAS in human platelets Evidence that activation of RAS is not sufficient to lead to ERK1-2 phosphorylation pot
... stimulatedplatelets, association of phosphorylated proteins with GRB2 was maximal at 10 s and was sustained for at least 240 s (Fig 3E) The time-course of RAS activation in response to convulxin and ... translocation of RAS to the insoluble fraction and secondary responses, aggregation mediated by the integrin GPIIb-IIIa was inhibited by EGTA and the activation mediated by thromboxane A2 and ADP ... supporting ERK1 activation [26], and kinase suppressor of RAS can bind RAF, MEK and ERK favouring activation of MEK and ERK1-2 through RAS [27] On the other hand, the RAS–ERK signalling pathway can be...
Ngày tải lên: 08/03/2014, 16:20
Báo cáo khoa học: b-Secretase cleavage is not required for generation of the intracellular C-terminal domain of the amyloid precursor family of proteins pot
... of total APPs and of APPsa [(B) and (D), respectively] were quantitated by densitometry, and values normalized versus WT control are presented as averages ± standard errors of duplicate measurements ... there is a discrete pool of FLAPP that is directed towards processing, and that a- secretases and b-secretases have access to the same cellular pool For APLP1, ablation of BACE1 resulted in a near ... for h at room temperature, washed as above, and visualized using an enhanced chemiluminescence kit (Pierce) and Hyperfilm MP (Amersham, GE Healthcare) Data analysis Band intensities were quantified...
Ngày tải lên: 15/03/2014, 10:20
Music theory is not nuclear physics
... Dorian “IIIm7” Phrygian “IVmaj7” Lydian “V7” Mixolydian “VIm7” Aeolian (Natural Minor) “VIIm7b5” Locrian Ionian & Aeolian are The Main Modes and the Main Key Centers for Traditional Classical Harmony ... has a Relative Minor Key Each Flat Key begins Major Scale Steps Down from the Root note of the Previous Key and keeps any Flats it had A New Flat is added at the 4th Step Each Sharp Key begins ... Octave, is always the same note as the First The Interval Formulas remain the same in all Keys! Each Major/Minor Key has the same interval structure, the same order of whole steps and half steps...
Ngày tải lên: 15/03/2014, 13:03
Báo cáo khoa học: "MIX Is Not a Tree-Adjoining Language" doc
... #) ← S( aa¯ aa¯ , #¯ a aaa) a a a a D(aa¯ aa¯ , aa¯ aaa) a a ¯ a F(aa¯ a, aaaa) a ¯ ¯ A( a, a) F (a , aa) a ¯ A( a, a) D (a , aa) a ¯ E (a a, aaa) a ¯ ¯ D (a , aa) a ¯ C(ε, #) A (¯ , a) a ¯ ... Peter Sells, Stuart M Shieber, and Thomas Wasow, editors, Foundational Issues in Natural Language Processing, pages 31–81 The MIT Press, Cambridge, MA Aravind K Joshi 1985 Tree-adjoining grammars: ... Structure Grammars, Head Grammars, and Natural Language Ph.D thesis, Department of Linguistics, Stanford University Kelly Roach 1987 Formal properties of head grammars In Alexis Manaster-Ramer, editor,...
Ngày tải lên: 16/03/2014, 19:20
odysseus is not a hero
... crew members killed at Cyclops¹ because he was being greedy.III) Odysseus is cold-hearted A) He kills people without giving them a chance 1) Suitors 2) Disloyal maids B) He doesn¹t care about people ... this.Outline I) Introduction A) The average definition for a hero B) What Odysseus is like compared to the definition C) Odysseus isn¹t a hero II) Odysseus is self centered A) He doesn¹t take ... Doesn¹t try to prevent deaths of crew membersIV) Odysseus is disloyal A) He had affairs with other women 1) Calypso 2) Circe B) Wife didn¹t betray him 1) with suitors 2) even though he was thought...
Ngày tải lên: 21/03/2014, 22:48
Đề tài " A new application of random matrices: Ext(C red(F2)) is not a group " ppt
... identically distributed (i.i.d.) Gaussian random variables with mean value and vari*This work was carried out, while the first author was a member of the MaPhySto – Centre for Mathematical Physics and ... “linearization trick”: Let A, B be unital C ∗ -algebras, and let x1 , , xr and y1 , , yr be operators in Asa and Bsa , respectively Assume that for all m ∈ N and all matrices 715 A NEW APPLICATION ... is not a group We start this section by translating Theorem 7.1 into a corresponding result, where the self-adjoint Gaussian random matrices are replaced by random unitary matrices and the semi-circular...
Ngày tải lên: 22/03/2014, 20:20
Báo cáo khóa học: Fidelity of targeting to chloroplasts is not affected by removal of the phosphorylation site from the transit peptide doc
... Incubation of GFP fused to the two mutant forms of the tobacco SSU transit peptide (pTSSU.tp .S3 4A- GFP and pTSSU.tp .S3 1A /S3 4A) , and with isolated pea chloroplasts Import is essentially the same as ... transit peptides of tobacco and pea SSU and Arabidopsis CtRS and HtRS, with the phosphorylation motif underlined and the predicted site of phosphorylation marked with an asterisk (C) Schematic ... of a phosphorylation motif in the transit peptides of tobacco SSU, pea SSU and dual-targeted Arabidopsis CtRS and HtRS (A) The consensus phosphorylation motif described by Waegeman and Soll [13]...
Ngày tải lên: 23/03/2014, 12:20
[Henry kellerman] love is not enough what it takes to make it work (2009)
... siblings and not as helpmates; rather, what happens is that one will be angry at the other and make an accusation or criticism, and then the other will join the fight and strenuously disagree, taking ... interested And when this is the case, it s usually because the one talking is being taken for granted and is essentially not seen as an equal and is not being considered as an equal Of course, this ... d, and e, and the moon, and the stars, and the gravitational pull on d and e.” Thus the discussion is shifted away from a + b = c to the effect of the moon and the stars on d and e: shifting, shifting,...
Ngày tải lên: 23/03/2014, 19:39
This factsheet is not exhaustive and does not bind the Court pot
... knowledge or consent while having a caesarean section in an East Slovak hospital They also claim a loss of social status, problems with their partners and serious medical side effects as a result The ... homologous insemination1, and that of S. H v Austria, which concerned access to donor insemination Although the question of access to PID raised delicate issues of a moral and ethical nature, the legislative ... abortion, in particular due to the lack of a clear legal framework, procrastination of medical staff and also as a result of harassment Violation of Article (right to respect for private and family life)...
Ngày tải lên: 28/03/2014, 16:20
Why American History is Not What They Say - An Introduction to Revisionism docx
... of: what is important?” Another way of saying this is that “ [a] n artist […] selects those aspects of existence which he regards as metaphysically significant and by isolating and stressing them, ... ‘important,’” and it is crucial that we understand, she says, that “[i]mportant”—in its essential meaning, as distinguished from its more limited and superficial uses—is a metaphysical term It pertains ... his conclusions, reactions or evasions into an emotional sum that establishes a habitual pattern and becomes his automatic response to the world around him What began as a series of single, discrete...
Ngày tải lên: 28/03/2014, 21:20
Hướng dẫn khắc phục lỗi “username is not in the sudoers file...” trong Ubuntu doc
... /etc/sudoers.d/ instead of # directly modifying this file # # See the man page for details on how to write a sudoers file # Defaults env_reset # Host alias specification # User alias specification ... alias specification # User privilege specification root ALL=(ALL:ALL) ALL # Members of the admin group may gain root privileges %admin ALL=(ALL) ALL # Allow members of group sudo to execute any ... /etc/sudoers.backup sudo nano /etc/sudoers - Và nhập đoạn mã vào file hiển thị: # # This file MUST be edited with the 'visudo' command as root # # Please consider adding local content in /etc/sudoers.d/...
Ngày tải lên: 30/03/2014, 00:20