a pronoun anaphora resolution system
Tài liệu Báo cáo khoa học: "A Pronoun Anaphora Resolution System based on Factorial Hidden Markov Models" docx
... so the antecedent oper-ation for non -anaphora pronoun it is set to be none.Finally, the system does not yet model cataphora,about 10 cataphoric pronouns in the testing datawhich are all counted ... the ACL Student Research Workshop, pages 19–24,Ann Arbor, Michigan.Zoubin Gha hramani and Michael I. Jordan. 1997. Facto-rial hidden markov models. Machine Learning, 29:1–31. A. Haghighi and ... models may be a valuable modelto resolve anaphora. AcknowledgmentsWe would like to thank the authors and maintainersof ranker models and emPronouns. We also wouldlike to thank the three anonymous...
- 10
- 430
- 0
The Design and Implementation of a Log-Structured File System
... separate data area is reserved for this purpose.The separate data area of these database systems meansthat they do not need the segment cleaning mechanisms ofthe Sprite LFS to reclaim log space. ... under grant CCR-8900029, and in partby the National Aeronautics and Space Administration and theDefense Advanced Research Projects Agency under contractNAG2-591.This paper will appear in the ... illustrates the fact that a log-structured file system produces a different form of locality on disk thantraditional file systems. A traditional file system achieveslogical locality by assuming certain...
- 15
- 1,434
- 0
Tài liệu Design of a Powerline Home Automation System pdf
... signal. Alarm system interface unit The alarm system delivered does not function as a complete home alarm system, but merely illustrates that the home automation system can interface ... interface with a larger existing alarm system. The alarm interface unit provides the home alarm system with an arm/disarm signal and reports back to the master unit the current integrity status of ... very important, as it means that on a noisy powerline circuit, home automation signals can be sent reliably, as long as the rate of transmission is low enough. Since a home automation system does...
- 55
- 699
- 1
Tài liệu A Hybrid Neural Fuzzy System for Statistical Process Control docx
... workfor various applications, data transformation is necessary to standardize the raw data into the value rangethat both neural network components can work with. Formulas for data transformation are ... operations,etc. A QC can be mathematically defined as a random variable, which is a function that takes values from a population or distribution. Denote a QC as random variable x . If a population ... Tables 18.6 (a) and (b), to Acosta and Pignatiello’s(1996) EWMA chart which adopts Roberts’ (1959) EWMA for mean and Wortham’s and Heinrich’s(1972) EWMA for variance.To obtain a fair comparison,...
- 22
- 716
- 1
Tài liệu Trade-Off Financial System Supply-Chain Cross-Contagion: a study in global systemic collapse. docx
... markets to crowd behaviour and ecosystems, they also share many similar dynamic features18. In figure 2 is a representation of a system, as a ball, at a particular time and in a particular ... De-localisation means that there are many more places and events that can transmit failure, and major structural stresses can build at a global scale. There is less local resilience to failure, ... years there are multiple routes to a large-scale breakdown in the global financial system, comprising systemic banking collapses, monetary system failure, credit and financial asset vaporization....
- 78
- 485
- 0
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc
... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... DNA poly-merase was purchased from Toyobo (Osaka, Japan). Emul-gen 911 was a gift from Kao Chemical (Tokyo, Japan).NADPH, NADH and NADP+were purchased fromOriental Yeast (Tokyo, Japan). a- Cyano-4-hydroxycinnamicacid ... Tmvalue of each protein at neutralpH. a Data from this study.bData from Griffin et al. [32].cData fromYano et al. [4].T. Mandai et al. Thermostable electron transport system FEBS Journal...
- 14
- 617
- 0
Tài liệu Báo cáo khoa học: Properties of ecdysteroid receptors from diverse insect species in a heterologous cell culture system – a basis for screening novel insecticidal candidates docx
... the aromatic moiety of dibenzoylhydrazines onlarvicidal activity against the Colorado potato beetleLeptinotarsa decemlineata. Pest Manag Sci 57, 858–865.36 Nakagawa Y, Minakuchi C, Takahashi ... Ogura T, Minakuchi C, Nakagawa Y, Smagghe G &Miyagawa H (2005) Molecular cloning, expression anal-ysis and functional confirmation of ecdysone receptorand ultraspiracle from the Colorado ... in a heterologous cell culture system – a basisfor screening novel insecticidal candidatesJoshua M. Beatty1, Guy Smagghe2, Takehiko Ogura3, Yoshiaki Nakagawa3, MargaretheSpindler-Barth4and...
- 12
- 627
- 0
Tài liệu Tracking Back References in a Write-Anywhere File System pdf
... thatblock.3 Use CasesThe goal of Backlog is to maintain meta-data that facil-itates the dynamic movement and reorganization of datain write-anywhere file systems. We envision two ma-jor cases ... in less than a sec-ond on a database immediately after maintenance. Thequery runs for smaller-scale applications, such as filedefragmentation, would vary considerably – anywherefrom a few blocks ... referenceimplementation with small, predictable overhead that re-mains stable over time. Our approach requires no diskreads to update the back reference database on block al-location, reallocation, or deallocation....
- 14
- 469
- 0
Tài liệu Báo cáo khoa học: "MemeTube: A Sentiment-based Audiovisual System for Analyzing and Displaying Microblog Messages" pdf
... We also integrate the sentiment-detection system with a real-time rule-based harmonic music and animation generator to display streams of messages in an audiovisual format. Conceptually, ... generating music melody au-tomatically based on detected sentiments, and (3) produce an animation of real-time piano playing for audiovisual display. Our MemeTube system can be accessed via: ... similar to what many people have proposed for evaluation (Davidov et al. 2010; Sun et al. 2010; Bifet and Frank 2010; Go et al. 2009; Pak and Paroubek 2010; Chen et al. 2010). We use data from...
- 6
- 449
- 0
- a native electron transport system for cyp175a1 has not been identified here
- ellipsis and anaphora resolution
- a statistical spoken dialogue system
- a robust machine translation system
- the environment of a computer aided translation system
- a spoken dialog qa system
- a mentionsynchronous coreference resolution algorithm
- a crosslingual ilp solution to zero anaphora resolution
- em works for pronoun anaphora resolution
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình xác định các nguyên tắc biên soạn khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam nội dung cụ thể cho từng kĩ năng ở từng cấp độ phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ lồng sóc các đặc tính của động cơ điện không đồng bộ đặc tuyến mômen quay m fi p2 đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha sự cần thiết phải đầu tư xây dựng nhà máy phần 3 giới thiệu nguyên liệu chỉ tiêu chất lượng 9 tr 25