a pronoun anaphora resolution system

Tài liệu Báo cáo khoa học: "A Pronoun Anaphora Resolution System based on Factorial Hidden Markov Models" docx

Tài liệu Báo cáo khoa học: "A Pronoun Anaphora Resolution System based on Factorial Hidden Markov Models" docx

... so the antecedent oper- ation for non -anaphora pronoun it is set to be none. Finally, the system does not yet model cataphora, about 10 cataphoric pronouns in the testing data which are all counted ... the ACL Student Research Workshop, pages 19–24, Ann Arbor, Michigan. Zoubin Gha hramani and Michael I. Jordan. 1997. Facto- rial hidden markov models. Machine Learning, 29:1– 31. A. Haghighi and ... models may be a valuable model to resolve anaphora. Acknowledgments We would like to thank the authors and maintainers of ranker models and emPronouns. We also would like to thank the three anonymous...

Ngày tải lên: 20/02/2014, 04:20

10 431 0
The Design and Implementation of a Log-Structured File System

The Design and Implementation of a Log-Structured File System

... separate data area is reserved for this purpose. The separate data area of these database systems means that they do not need the segment cleaning mechanisms of the Sprite LFS to reclaim log space. ... under grant CCR-8900029, and in part by the National Aeronautics and Space Administration and the Defense Advanced Research Projects Agency under contract NAG2-591. This paper will appear in the ... illustrates the fact that a log-structured file system produces a different form of locality on disk than traditional file systems. A traditional file system achieves logical locality by assuming certain...

Ngày tải lên: 12/09/2012, 15:05

15 1,4K 0
Tài liệu Design of a Powerline Home Automation System pdf

Tài liệu Design of a Powerline Home Automation System pdf

... signal. Alarm system interface unit The alarm system delivered does not function as a complete home alarm system, but merely illustrates that the home automation system can interface ... interface with a larger existing alarm system. The alarm interface unit provides the home alarm system with an arm/disarm signal and reports back to the master unit the current integrity status of ... very important, as it means that on a noisy powerline circuit, home automation signals can be sent reliably, as long as the rate of transmission is low enough. Since a home automation system does...

Ngày tải lên: 19/01/2014, 20:20

55 699 1
Tài liệu A Hybrid Neural Fuzzy System for Statistical Process Control docx

Tài liệu A Hybrid Neural Fuzzy System for Statistical Process Control docx

... work for various applications, data transformation is necessary to standardize the raw data into the value range that both neural network components can work with. Formulas for data transformation are ... operations, etc. A QC can be mathematically defined as a random variable, which is a function that takes values from a population or distribution. Denote a QC as random variable x . If a population ... Tables 18.6 (a) and (b), to Acosta and Pignatiello’s (1996) EWMA chart which adopts Roberts’ (1959) EWMA for mean and Wortham’s and Heinrich’s (1972) EWMA for variance. To obtain a fair comparison,...

Ngày tải lên: 23/01/2014, 01:20

22 716 1
Tài liệu Trade-Off Financial System Supply-Chain Cross-Contagion: a study in global systemic collapse. docx

Tài liệu Trade-Off Financial System Supply-Chain Cross-Contagion: a study in global systemic collapse. docx

... markets to crowd behaviour and ecosystems, they also share many similar dynamic features 18 . In figure 2 is a representation of a system, as a ball, at a particular time and in a particular ... De-localisation means that there are many more places and events that can transmit failure, and major structural stresses can build at a global scale. There is less local resilience to failure, ... years there are multiple routes to a large- scale breakdown in the global financial system, comprising systemic banking collapses, monetary system failure, credit and financial asset vaporization....

Ngày tải lên: 17/02/2014, 21:20

78 485 0
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... DNA poly- merase was purchased from Toyobo (Osaka, Japan). Emul- gen 911 was a gift from Kao Chemical (Tokyo, Japan). NADPH, NADH and NADP + were purchased from Oriental Yeast (Tokyo, Japan). a- Cyano-4-hydroxycinnamic acid ... T m value of each protein at neutral pH. a Data from this study. b Data from Griffin et al. [32]. c Data from Yano et al. [4]. T. Mandai et al. Thermostable electron transport system FEBS Journal...

Ngày tải lên: 18/02/2014, 08:20

14 617 0
Tài liệu Báo cáo khoa học: Properties of ecdysteroid receptors from diverse insect species in a heterologous cell culture system – a basis for screening novel insecticidal candidates docx

Tài liệu Báo cáo khoa học: Properties of ecdysteroid receptors from diverse insect species in a heterologous cell culture system – a basis for screening novel insecticidal candidates docx

... the aromatic moiety of dibenzoylhydrazines on larvicidal activity against the Colorado potato beetle Leptinotarsa decemlineata. Pest Manag Sci 57, 858–865. 36 Nakagawa Y, Minakuchi C, Takahashi ... Ogura T, Minakuchi C, Nakagawa Y, Smagghe G & Miyagawa H (2005) Molecular cloning, expression anal- ysis and functional confirmation of ecdysone receptor and ultraspiracle from the Colorado ... in a heterologous cell culture systema basis for screening novel insecticidal candidates Joshua M. Beatty 1 , Guy Smagghe 2 , Takehiko Ogura 3 , Yoshiaki Nakagawa 3 , Margarethe Spindler-Barth 4 and...

Ngày tải lên: 18/02/2014, 08:20

12 628 0
Tài liệu Tracking Back References in a Write-Anywhere File System pdf

Tài liệu Tracking Back References in a Write-Anywhere File System pdf

... that block. 3 Use Cases The goal of Backlog is to maintain meta-data that facil- itates the dynamic movement and reorganization of data in write-anywhere file systems. We envision two ma- jor cases ... in less than a sec- ond on a database immediately after maintenance. The query runs for smaller-scale applications, such as file defragmentation, would vary considerably – anywhere from a few blocks ... reference implementation with small, predictable overhead that re- mains stable over time. Our approach requires no disk reads to update the back reference database on block al- location, reallocation, or deallocation....

Ngày tải lên: 19/02/2014, 18:20

14 469 0
Tài liệu Báo cáo khoa học: "MemeTube: A Sentiment-based Audiovisual System for Analyzing and Displaying Microblog Messages" pdf

Tài liệu Báo cáo khoa học: "MemeTube: A Sentiment-based Audiovisual System for Analyzing and Displaying Microblog Messages" pdf

... We also integrate the sentiment-detection system with a real-time rule-based harmonic music and animation generator to display streams of messages in an audiovisual format.  Conceptually, ... generating music melody au- tomatically based on detected sentiments, and (3) produce an animation of real-time piano playing for audiovisual display. Our MemeTube system can be accessed via: ... similar to what many people have proposed for evaluation (Davidov et al. 2010; Sun et al. 2010; Bifet and Frank 2010; Go et al. 2009; Pak and Paroubek 2010; Chen et al. 2010). We use data from...

Ngày tải lên: 20/02/2014, 05:20

6 449 0

Bạn có muốn tìm thêm với từ khóa:

w