a multi purpose function in proteomics

... through GWAS in the Singapore Chinese, Malays and Asian-Indians A metaanalysis of similar studies in other East Asian populations was performed in order to clarify the importance and relevance of ... prevalence rate of T2DM in Singapore (~9%) is comparable to those in the United States and Europe Singapore has a multi- ethnic population comprising mainly Chinese, Malays and Asian-Indians These ... the Chinese, Malay and Asian-Indians in Singapore Presented at the inaugural Asian Association for the Study of Diabetes in Osaka, Japan (2009) TABLE OF CONTENTS 10 11 12 13 14 15 16 17 Acknowledgements...

Ngày tải lên: 14/09/2015, 08:48

... three-column area and set it in contrasting styles a large, light serif and a small, bold san-serif that the eye can tell apart at a glance As with the headline, the rectangular field defines the space ... updated bathroom, and a spacious backyard Perfect for a small and a spacious backyard Perfect for a small family looking for a place to call home Close family looking for a place to call home Close ... larger than the others as it is here in desirable area Features include newly re- $435,000 Well maintained charming home finished hardwood floors, updated bathroom, in desirable area Features include...

Ngày tải lên: 01/03/2016, 22:21

... Response and Intervention Trial ANZICS-APD, Australian and New Zealand Intensive Care Society Adult Patient Database tals, and tertiary hospitals In these hospitals, data were obtained for the years ... hospitals that had not introduced an MET service using the first year of data as baseline and the second year as comparator Finally, an additional and similar analysis was performed for hospitals ... undertaken using the information contained within the database Assessment on timing of introduction of MET service We obtained information from a database maintained by the ANZICS ARCCCR and derived...

Ngày tải lên: 25/10/2012, 10:35

... medication within the last seven days before the examination was ascertained by an instrument for database-assisted online collection of medication data (IDOM) [19] The following substance classes ... other antihypertensive treatment is associated with reduced lung function in a general adult population Thus, our findings may serve as a basis for experimental testing, as for example by adding ... Greifswald, Greifswald, Germany 7Central Hospital of Augsburg, MONICA/KORA Myocardial Infarction Registry, Augsburg, Germany 8Ludwig-Maximilians-University, Institute of Medical Data Management,...

Ngày tải lên: 25/10/2012, 10:45

... Some addresses 105 Training to promote race equality Peter Ferns and Mita Madden Defining race equality training Context of race equality training Race equality training programmes Evaluation and ... teacher, Amanda had an interest in multicultural and anti-racist education and spent a year in India researching the education of children Later, while working at the Confederation of Indian Organisations, ... peoples is hailed as an ‘anomaly’ and the paper indicates that these so-called anomalies are found among black Americans, Africans, Asians and ‘American Indians’ It is not necessarily the racial prejudices...

Ngày tải lên: 15/02/2014, 02:20

... CTTTGTTATTTATTATGCATTCCTATGGTGAGTT AACTCACCATAGGAATGCATAATAAATAACAAAG CTTTGTTAAAGCTTATGCATTCCTATGGTGAGTT AACTCACCATAGGAATGCATAAGCTTTAACAAAG CCTCTTACACTTGCTTTTGAC GCAAAGGTGCCTTTGAGGTTG GACCCCTTCATTGACCTCAACTA ... CGGAAGATCTGGGATCATGCCCATTTAG TACGAGATCTTAGCTACATTAAATAGGC GGGATCATGCCCAAGCTTATTTTCCTTACT AGTAAGGAAAATAAGCTTGGGCATGATCCC GCTCACTGCCTAAGCTTTGTAGCTAATAAAG CTTTATTAGCTACAAAGCTTAGGCAGTGAGC CTTTGTTATTTATTATGCATTCCTATGGTGAGTT ... GACCCCTTCATTGACCTCAACTA CTTGATTTTGGAGGGATCTC TTAGCTACATTAAATAGGCAG GtaatacgactcactataGGGATCATGCCCATTTAG Forward (nt 1281–1298 PAI-2) Reverse (nt 1860–1843 PAI-2) Forward (nt 1491–1508 PAI-2) Reverse...

Ngày tải lên: 16/02/2014, 09:20

... membrane and immunoblotted with an anti-actin mAb (left) Equivalent amounts of purified yeast actin were used in each binding assay and an amount representing 10% of the load used in each binding assay ... pAM237 pAM241 pAM252 pAM253 pAM872 pAM873 pAM874 pAM875 pAM876 pAM877 pAM878 pAM879 pAM880 pAM881 pAM882 pAM883 pAM884 pAM885 pAM886 pAM887 pAM888 pAM889 pAM890 pAM891 pAM892 pAM895 pAM896 pAM899 ... GFP-specific antiserum was a gift from J Kahana and P Silver (Dana Farber Cancer Center, Boston, MA) The anti-actin mAb was MAB1501 from Chemicon International (Temecula, CA) The anti-hexokinase rabbit...

Ngày tải lên: 18/02/2014, 16:20

... multifunctional singlestrand RNA/DNA binding protein, PTB [43–46,52–57], and that the binding of this complex may be involved in general VEGF mRNA stabilization The CSD/PTB-containing cytoplasmic ... expression in endothelial cells and cardiac myocytes J Mol Cell Cardiol 33, 2179–2187 11 Tanaka, T., Kanai, H., Sekiguchi, K., Aihara, Y., Yokoyama, T., Arai, M., Kanda, R & Kurabayashi, M (2000) Induction ... than hypoxia CSD/PTB complexes could also play a role in general insulin mRNA stability, as PTB has recently been implicated in insulin mRNA stabilization in normoxic conditions [62] Interestingly,...

Ngày tải lên: 19/02/2014, 12:20

... other hand, is assumed to be an increasing cost industry: at the margin, expanding organic production requires additional farmersupplied inputs that are available only at increasing cost To capture ... Biotechnology and Organic Agriculture: National Organic Standards, Labeling and Second-Generation of GM Products Paper presented at the AAEA annual meeting, Montreal, Canada, July Golan, E., Kuchler, ... food (set at its baseline value) The results are presented in Table 23 Table Sensitivity Analysis on Labelling and Traceability Costs Baseline t Variable Labelling and traceability costs t n...

Ngày tải lên: 05/03/2014, 20:20

... types of financial transactions they are most related to Paragraphs that did not fall into a category of interest were classified as “other” The annotated paragraphs were divided into random 4x4 ... users indicate whether the paragraph is to be treated as a positive or a negative example of the category they are elaborating In our preliminary studies, we were able to achieve the peak performance ... leading us to investigate visual ways to define queries that go beyond the paragraph and span many texts over many years Finally, we are hoping to conduct user studies to validate our fundamental...

Ngày tải lên: 08/03/2014, 21:20

... (and GST alone) after incubation with equal amounts of in vitro translated 35 S-labelled DYS-1 The signal intensity of the autoradiogram was quantitated with a radiographic analyser (Biorad) MW, ... the in vivo function of Dyb-1, we created transgenes Fig Yeast two-hybrid assay A plate containing SD media minus leucin, tryptophan and histidine was seeded with yeast carrying DNABD-Dys-1 and ... (typically 0–10 min) The reactions were stopped by adding EGTA to mM and heating at 65 °C for 10 DNA was purified on a Wizard column (Promega) and the action of BAL31 was checked by loading an aliquot...

Ngày tải lên: 08/03/2014, 23:20

... and appear granular Oocytes are at intercalary and protoplasmic growth phase AG are completely formed and usually white Gonad is large, usually dullwhite Spermatozoa accumulate in testis ampullae ... spermatophoric gland Stage VI Mature sexual cells pass through the accessory glands In all cephalopod females this stage occurs at spawning In males, spermatophores accumulate in the distal part ... female octopus, mucous egg mass of female squid and spermatophores of male squid Therefore, it seems inappropriate to include functional maturation and maturity in a single maturity stage (as in...

Ngày tải lên: 14/03/2014, 16:20

... appropriate primers (Pf LDH: forward 5¢-ATGGCACCAAAAGCAAAAATCG-3¢ and reverse 5¢-AGCTAATGCCTTCATTCTCTTAG-3¢; Pf MQO forward 5¢-ATGATATGTGTTAAAAATATTTTG-3¢ and reverse 5¢-TCATAAATAATTAACGGGATATTCG-3¢) ... LEIVNLHA—-SPYVAPAAAIIEMAESYLKDLKKVLICSTLLE-G-QYGHSD-IFGGTPVV AEIIKLAK-ASAAFAPAAAITKMIKSYLYNENNLFTCAVYLN-G-HYNCSN-LFVGSTAK GEIVKLLKTGSAYYAPAASAIAMLESYLKDKRQILTCAAYLQ-G-EYDIHD-LYIGVPII AEIVGLLKTGSAYYAPAASAIEMAESYLKDKKRVLPCAAHLS-G-QYGVKD-MYVGVPTV ... NADP/NADPH as an alternate cofactor, having been tested up to maximum concentration of 100 mM A surprising observation was the use of acetyl pyridine adenine dinucleotide (APAD/ APADH) as an alternate...

Ngày tải lên: 16/03/2014, 18:20

... (Goddeau, 1996), and a plan-based model (Litman, 1987) However, a finite-state model has a weak point that dialogue flows should be predefined Although a plan-based model can manage complex dialogue ... phenomena using plan inference, a plan-based model is not easy to be applied to the real world applications because it is difficult to maintain plan recipes In this paper, we propose a statistical ... of speakers’ intentions; a pair of a current intention and a next intention) that are extracted from a sequence of utterances in a current dialogue • Domain knowledge-level feature: In a goaloriented...

Ngày tải lên: 17/03/2014, 02:20

... parameters in detail Second, we plan to appreciably enhance the integrated model It appears from both our initial data analysis, as well as our qualitative examination of the data, that the pairs make ... M., Mampilly, T., Sharma, V., et al (200 5a) Natural noun phrase variation for interactive characters In Proceedings of 1st Annual Artificial Intelligence and Interactive Digital Entertainment ... behavior in the presence of visual information could enable agents to emulate many elements of more natural and realistic human conversational behavior A computational model may also make valuable...

Ngày tải lên: 24/03/2014, 03:20

... 4-kDa peptide N-terminal primer: 5¢-AACCATGGCTAAAGCAGATTGTAATGG TGCATGT-3¢; the 4-kDa peptide C-terminal primer: 5¢-AAGAATTCTTATTATCCAGTTGGATGTATGCA GAA-3¢ The amplified sequence was cloned into ... insulin pharmacophore, IleA2-ValA3 at the A- chain N-terminus, TyrA19 at the A- chain C-terminus, and ValB12 and TyrB16 at the B-chain central helix assume essentially the same spatial arrangements ... protein was detected with anti-(4-kDa peptide) Ig Ligand: (A) normal 4-kDa peptide; (B) Arg16fiAla mutant; (C) Val29fiAla mutant; (D) Phe31fiAla mutant signalling pathway This signalling mechanism...

Ngày tải lên: 31/03/2014, 07:20

... describe a logic programming approach to obtaining a parse and an initial logical formula for sentences containing a fairly broad range of CEs They not discuss lexical semantics and thus not deal with ... must have the same codomain However, this is impossible since all width mappings will have LENGTH as a codomain, and all weight mappings will have WEIGHT as a codomain The Codomain Agreement Principle ... applicable MTraus rule, can serve as the translation of a mapping in an EL formula Assume that for an EL predication (big~ w a) in a given context there are three applicable MTrans rules translating...

Ngày tải lên: 31/03/2014, 18:20

... Computer Application Strategy The use of Computer-Aided Qualitative Data Analysis Software (CAQDAS) is an issue which has generated increasing interest in the qualitative research field since computers ... within the categorization imposed by CAQDAS Finally, the real or imagined gains in productivity of CAQDAS may shortchange the benefits of spending a large amount of time manually reviewing the data, ... TAM used in evaluation of IT in post-secondary education of African-American students Finally, the author of this dissertation proposal used the TAM last year in a published project evaluating...

Ngày tải lên: 03/06/2014, 02:14

... T, Nakanishi K, Shimada A, Uga M, Kurihara S, Kawabata Y, et al: Genetic association between the interleukin-2 receptor-alpha gene and mode of onset of type diabetes in the Japanese population ... polymorphisms in the IL2RA gene are associated with age at diagnosis in late-onset Finnish type diabetes subjects Immunogenetics 2010, 62:101-107 36 Kawasaki E, Awata T, Ikegami H, Kobayashi T, Maruyama ... immune tolerance requires a finely controlled balance between maintaining tolerance to self-antigens and mounting protective immunity against enteric and invading pathogens [1] Self-reactive T cells...

Ngày tải lên: 18/06/2014, 16:20

... pneumonia treatment errors in- depth Case-management quality among IMCI-trained health workers The in- depth examination of errors by IMCI-trained health workers via graphical pathway analysis allowed ... physicians in Brazil found that caseload was inversely associated with consultation time, with the association being strongest at caseloads over 50 per day, and that quality of care was highest in ... quality in Morocco Int J Qual Health Care 2006, 18:134-144 Armstrong Schellenberg JRM, Adam T, Mshinda H, Masanja H, Kabadi G, Mukasa O, John T, Charles S, Nathan R, Wilczynska K, Mgalula L, Mbuya...

Ngày tải lên: 18/06/2014, 17:20