a history of addiction in medical personnel
Tài liệu The Economic Implications of Fewer International Higher Education Students in Australia ppt
... Domestic Factors Reputational damage: Violent attacks in 2009 on international (particularly Indian) students in Australia have resulted in damaging publicity in India. Despite ... Kenyon, P and Koshy, P (2003) The Economic Benefits to Australia from International Education, A Report Prepared for Australian Education International (AEI) – International Education Network, Canberra: Australian Government; Access Economics (2009), op. cit. ... The Economic Implications of Fewer International Higher Education Students in Australia • A stronger Australian dollar; • The impact of the global financial crisis on demand for places; • Increased ...
- 44
- 546
- 0
An Assessment of the Environmental Implications of Oil and Gas Production: A Regional Case Study pot
... Washington, and the Canadian provinces of British Columbia and Manitoba forged an agreement establishing the initiative Since that time, Montana and Utah have also signed on as participants, and Alaska, ... fine particulates in certain areas of the state and is waiting to be redesignated • Utah had two areas in nonattainment for SO2 emissions which are now meeting the standards Utah has several areas ... be redesignated: • Montana had 10 areas in moderate nonattainment for PM standards and a couple of areas in nonattainment for SO2 Montana has released several State Implementation Plans (SIPs)...
- 115
- 744
- 0
E-Tribalized Marketing?: The Strategic Implications of Virtual Communities of Consumption ppt
... connoisseurship of fine wine Meta-analyses of computer-mediated communication indicates that Internet users progress from initially asocial information gathering to increasingly affiliative social activities ... Understanding four primary interaction modes — informational, relational, recreational, and transformational — will allow an interaction-based segmentation that can help to pinpoint the virtual communities ... operationalized as an extension of information technology and micromarketing pursuits This has concentrated online marketing on the many advantages of database marketing While useful in many...
- 13
- 504
- 0
Báo cáo y học: " The clinical implications of adult-onset henoch-schonelin purpura" docx
... predominance Plus at least one of the following criteria: Diffuse abdominal pain IgA deposition in any biopsy Arthritis/arthralgia Renal involvement (hematuria and/or proteinuria) American College of ... beta) have been associated with increased risk of renal involvement [24-26] Age of onset, the presence of renal impairment and hematuria at the onset, abdominal pain as an initial presentation, ... 1A and 1B) This was accompanied by crampy lower abdominal pain and hematuria Punch biopsy of involved skin demonstrated leukocytoclastic vasculitis, accompanied by deposition of IgA on vascular...
- 7
- 394
- 0
Do investors fully understand the economic implications of cash flows from operations
... accrual variables are defined the same as in Barth et al (2001): AARt, change in accounts receivable, AINVt, change in inventory, AAPt, change in accounts payable, DEPAMOt, depreciation and amortization ... operating, financing and investing cash flows The current aggregate operating cash flows have incremental value over eamings or accmals in predicting future cash flows and its incremental information ... filings obtained from websites ofEdgarScan, EdgarOnline, and the Lexis/Nexis database Other financial statement data and stock retum data are from CRSP and Compustat Annual Industrial and Research...
- 85
- 467
- 0
báo cáo khoa học: " Coerced addiction treatment: Client perspectives and the implications of their neglect" pps
... life-course approach toward the study of addiction and treatment careers may also offer guidance in this area [121] By explicitly incorporating aspects of the social context, including social capital and ... Scholarships in Science and Technology program, the CIHR Strategic Training Program in Research in Addictions and Mental Health Policy, and grant funding from the Canadian Institutes of Health Research ... strategy This review involved a search of the English-language academic and evaluation literature pertaining to social pressures and coercion to enter addiction treatment Electronic databases, including...
- 10
- 328
- 0
Tài liệu Linking the Gaza Strip with the West Bank: Implications of a Palestinian Corridor Across Israel docx
... Bank and Gaza total area is 2,316 sq.mi.) Persian Gulf South China Sea Manama Malaysia Indonesia Brunei 2,227 sq.mi Malaysia Gulf of Bahrain Qatar page 45 Bandar Seri Begawan Saudi Arabia Bahrain ... as a one of the attached maps Every person that wished to use joint Jordanian-Palestinian delegation Although bilateral safe passage had to carry a safe passage card or a safe and multilateral ... comprised of a mainland and islands, such as Australia, which consists of the mainland and islands including Tasmania, Norfolk, and very distant islands like Christmas and Keeling A state can also...
- 64
- 307
- 0
Tài liệu The Legal and Economic Implications of Electronic Discovery pptx
... activity Actual and potential plaintiffs often begin by first threatening legal action, then hiring an attorney, making a specific demand, filing a formal complaint, submitting legal briefs, designating ... identifiable case characteristics Litigation Costs and Benefits At any particular point, plaintiffs and defendants have expectations based on available information about likely legal outcomes For example, ... logs, and temporary files, potentially leaving a detailed audit trail of internal corporate processes that was never imaginable before Additionally, many application files (such as a Microsoft Word...
- 40
- 410
- 0
Tài liệu Cleaner Water in China? The Implications of the Amendments to China’s Law on the Prevention and Control of Water Pollution pptx
... widespread municipal and industrial dumping has contaminated much of the water, leaving sections of many rivers unsafe for any human use.1 In fact, water pollution is so widespread that regulators say ... has been “practice ahead of legislation, local legislation ahead of state legislation.”41 This has led to a permit system that “integrate[d] state laws, regulations, standards, policies, and administrative ... tool, the scope of who can sue should be expanded in China On the other hand, an interesting aspect of China’s law is that in a lawsuit, the discharging party has the burden of proving both why...
- 22
- 661
- 0
Tài liệu Báo cáo Y học: BIGH3 (TGFBI) Arg124 mutations influence the amyloid conversion of related peptides in vitro Implications in the BIGH3-linked corneal dystrophies pptx
... autosomal dominant corneal diseases linked to mutations in the BIGH3 gene are a prominent cause of corneal blindness in adulthood Conventional therapies remain unsatisfactory due to the high rate and ... M., Shimomura, Y., Nishida, K., Inoue, Y., Watanabe, H., Maeda, N., Kurahashi, H., Kinoshita, S., Nakamura, Y & Tano, Y (1998) A kerato-epithelin (beta ig-h3) mutation in lattice corneal dystrophy ... degree of amyloid fibril formation Cysteine has the capacity to form disulfide bonds As disulfide bonding of the protein may participate in the appearance of aggregates and predispose to the formation...
- 8
- 469
- 0
Tài liệu Research evaluation of economic, social, and ecological implications of the programme for commercial tree plantations: case study of rubber in the south of Laos PDR pptx
... Viet-Lao, DakLak, and Dau Tieng companies have an agreement to invest in and plant rubber over an area of more than 30,000 ha, in Champassak province and Salavane, in the south of Laos According ... Pornpana Kuaycharoen Ms Rebeca Leonard Field assistants Sinakhone Soukhavong Sengmany Kaewlakodphosy Lampan Xayalade Champaphai Khambuasy Somdy Phrommasen Khamsane Kiddisak Sysomphon Kaewvilayvong ... forest land, water area areas, industrial land, communications land, cultural land, national defence land, national peace and security land, and construction land “The area of land in Lao PDR includes...
- 135
- 708
- 0
Báo cáo khoa học: Binding of ATP at the active site of human pancreatic glucokinase – nucleotide-induced conformational changes with possible implications for its kinetic cooperativity doc
... Karger, Basel 24 Marotta DE, Anand GR, Anderson TA, Miller SP, Okar DA, Levitt DG & Lange AJ (2005) Identification and characterization of the ATP-binding site in human pancreatic glucokinase Arch ... Contact area in percentage of exposed area for residues interacting with Glc and ATP in the binary complex Table S2 Domain motions in the conformational transitions induced by Glc and ATP binding ... associated with ATP binding; (c) obtaining insights into the active site contact residues involved in ATP binding; and (d) relating this information to steady-state enzyme kinetic data To achieve...
- 15
- 374
- 0
Báo cáo khoa học: MR solution structure of the precursor for carnobacteriocin B2, an antimicrobial peptide fromCarnobacterium piscicola Implications of the a-helical leader section for export and inhibition of type IIa bacteriocin activity pdf
... antimicrobial activity [2,10] For example, Fimland et al [42] have shown that interchange of large domains of different type IIa bacteriocins, such as pediocin PA-1, sakacin P, and curvacin A, gives ... voltage of 20 kV using a nitrogen laser (k ¼ 337 nm) Samples were prepared using a- cyano-4hydroxycinnamic acid (Aldrich) or sinapinic acid (Aldrich) as a matrix, and fixed to a gold or stainless-steel ... VNYGNGVSCSKTKCSVNWGQAFQERYTAGINSFVSGVASGAGS IGRRP [19] Sakacin G Plantaricin 423 Piscicolin 126 CbnBM1 Leucocin A Pediocin Mesentericin Y105 Sakacin A Divercin V41 Sakacin P MKNAKSLTIQEMKSITGG MMKKIEKLTEKEMANIIGG...
- 9
- 519
- 0
Characteristics and Regulation of Exempt Institutions and the Implications of Removing the Exemptions pptx
... banks The management and board of directors of such a holding company are often the same as that of the bank 45 A holding company can be organized in various ways All holding companies have a ... excessive investment risks and fail The failure of a holding company or affiliate can impair an insured institution’s access to financial markets Moreover, a poorly managed bank holding company can initiate ... filings, company 2010 annual reports, and OTS data a Noncommercial holding companies are generally financial in nature According to information from OCC, one trust bank owned an affiliate as of...
- 64
- 875
- 0
Environmental Implications of the Tourism Industry pdf
... habits of birds in Antarctica (Sirakaya & McLellan, 1998, p 43) In January of 1988 an Argentine naval vessel carrying paying tourists ran aground off the coast of Antarctica, spilling 250,000 gallons ... www.earthisland.org/eijournal/fall99/dis_fall99ecotourism.html) American Society of Travel Agents (1995) ASTA Travel Agent Manual Alexandria, VA: ASTA [On-line] Available: www.astanet.com Andereck, Kathleen L ... have transformed the Hawaiian capital from a picturesque crossroads to something approaching an outpost of Southern California.” The character and architectural beauty of Jerusalem was similarly...
- 49
- 417
- 0
Addressing the Impact of Household Energy and Indoor Air Pollution on the Health of the Poor: Implications for Policy Action and Intervention Measures pot
... Table Annual burden of disease attributable to solid fuel use, early 1990s Region India China Other Asia & Pacific Islands Sub-Saharan Africa Latin America Mid-East and North Africa LDC Total ... developing countries Table Percentage of total LDC burden attributable to solid fuel use Region India China Other Asia & Pacific Islands Sub-Saharan Africa Latin America Mid-East and North Africa ... of traditional biomass fuels (wood, charcoal, animal dung, and crop wastes) and coal is a significant public health hazard predominantly affecting poor rural and urban communities in developing...
- 52
- 578
- 0
SOCIAL IMPLICATIONS OF THE INTERNET pdf
... accompanied by a commodification of attention A rapidly evolving mosaic of search engines and pointof-entry sites compete for dominance (NUA 200 0a) , playing a pivotal role in channeling users’ attention ... capital Indeed, an increasing body of literature suggests that the Internet enhances social ties defined in many ways, often by reinforcing existing behavior patterns A report on a national survey of ... depict information technology as transforming organizations: replacing hierarchical bureaucracy with flat, networked structures in which local initiative supplants authoritative command; and replacing...
- 30
- 508
- 0
Nano means one billionth major aspects of nanotechnology what is it how did it come about what are the social implications
... irregular protein from the cell on the lower right, and a cylindrical gear made by molecular manufacturing at top left (F) shows two atoms in the protein, (G) reveals the nucleus of the atom as a tiny ... atoms spell out a familiar logo A demonstration on the molecular level A nano-motor manipulated by two laser beams Major Aspects of Nanotechnology •What is it? •How did it come about? •What are ... Nanotechnology - Deals with moleculues between one and one hundred nanometers in diameter Manipulating individual atoms and manufacturing from the bottom up Major Aspects of Nanotechnology •What is it?...
- 17
- 617
- 0
Shanghaied - The Economic and Political Implications of the Flow of Information Technology and Investment Across the Taiwan Strait ppt
... Engineering, Inc ASEAN Association of South-East Asian Nations BoFT Bureau of Foreign Trade BVI British Virgin Islands CAAC Civil Aviation Administration of China CAL China Airlines CAS Chinese Academy ... plan, which offers to better any financial incentive offered by Shanghai by an additional year Both Shanghai and Beijing have announced goals of attracting certain numbers of IC fabs that far ... time in moving Foreign Direct Investment (FDI) into China In 1993 there were already 35 Taiwanese subsidiaries in China as against 10 in Thailand, nine in Malaysia, and four in Indonesia The...
- 218
- 561
- 0
Báo cáo khoa học: Zinc-binding property of the major yolk protein in the sea urchin ) implications of its role as a zinc transporter for gametogenesis ppt
... ovary at stage 1, and remained at a similar value to stage Testes at stage were not analyzed because of a lack of samples We calculated the amount of zinc bound to MYP in the gonad by multiplying ... synthesis and accumulation of MYP and its involvement in zinc transport in male and female sea urchins Two pathways are possible from amino acids in the digestive tract to MYP in the gonad (1) Amino acids ... zinc concentration of the solutions was measured by ICP-AES The data were analyzed using prism software (GraphPad Software, San Diego, CA, USA) Injection of labeled protein into sea urchins Lactoferrin...
- 14
- 442
- 0
Tìm thêm: xác định các mục tiêu của chương trình khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu mở máy động cơ lồng sóc mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ hệ số công suất cosp fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008