2 2 water chilling packages minimum efficiency requirements

... )7G5 62: DGD49G5405J::436G5488D:D7HG5675HJ5

Ngày tải lên: 25/12/2013, 10:47

... observed on d2 42, d244, d286, but not on d204, d216, d238 and d2 72 With was Under the droughted conditions, A was significantly stimulated in the elevated [CO ] treatment only on d244, while no ... (fig 6) Intrinsic water- use efficiency was higher under elevated than under ambient CO on d216 and d239 only Water- use efficiency and carbon isotope discrimination Water- use efficiency (W) was ... under ambient [CO on all measurement dates but not ] on d204, d216, d244 and d2 72 The mean values of A/g were positively linked with / p 2 (r 0.78, P < 0.01; r 0.71, P < 0.01 under 350 and 700...

Ngày tải lên: 08/08/2014, 18:21

... ml) 120 ± 25 126 ± 23 133 ± 57 Plasma [glucose] posttraining (mg / 100 ml) 115 ± 22 120 ± 22 122 ± 35 Significance n.s n.s n.s HbA1C At baseline the HbA1c amounted to 6,7 % ± 0 ,26 (FT), 6,8 % ... Strength (13) 63,3 ± 5,9 62, 9 ± 7,3 62, 2 ± 4,0 88,6 ± 24 ,1 86,5 ± 14,7 83,3 ± 13,4 173 ± 14 ,2 1 72 ± 6,7 177 ± 7 ,2 Vibration (14) Systolic blood pressure (mm Hg) 136 ± 13,8 1 42 ± 16 ,2 137 ± 15,1 Diastolic ... Rehabil 20 05; 86: 1 527 – 33 Dunstan DW, Daly RM, Owen N, et al High-intensity resistance training improves glycemic control in older patients with type diabetes Diabetes care 20 02; 25 : 1 729 – 36...

Ngày tải lên: 26/10/2012, 10:04

... 46 Activity 6 .2: Determining Requirements, Wants, and Constraints Exercise 1: Determining Requirements ! Review case study for requirements (10 minutes) Review the case ... study, you should be able to determine the requirements that are critical from business and user perspectives Requirement Activity 6 .2: Determining Requirements, Wants, and Constraints Exercise ... back to user for more information) Priority Want 47 48 Activity 6 .2: Determining Requirements, Wants, and Constraints Exercise 2: Determining Constraints ! Review case study for constraints (10...

Ngày tải lên: 22/10/2013, 16:15

... and as of 20 02, RO represented 43.5 percent of the capacity of all desalination plants greater than 0. 026 mgd, approximately equal to the thermal desalination capacity (Wangnick, 20 02) As noted ... and Water Purification Technology Roadmap http://www.nap.edu/catalog/109 12. html Review of the Desalination and Water Purification Technology Roadmap http://www.nap.edu/catalog/109 12. html 32 Review ... distillate even in seawater applications Summary of Cost Issues Wangnick (20 02) notes that energy use represents 59 percent of the typical water costs from a very large thermal seawater desalination...

Ngày tải lên: 15/12/2013, 11:15

... 12 Activity 3 .2: Relating Data Requirements to Conceptual Design Exercise 1: Analyzing Your Own Experience of Conceptual ... project Then answer the following questions: a How is conceptual design supported by: Data requirements Use cases Requirements validation b Is there such a thing as “conceptual data design”? ...

Ngày tải lên: 21/12/2013, 06:16

... Rated current A 10 12 16 20 25 32 40 50 63 80 1O0 125 160 20 0 25 0 315 400 500 630 800 O00 125 0 Cross-sởctionai area rnmZ 1,5 1,5 23 2. 5 2. 5 10 16 25 25 35 50 70 95 120 185 24 0 x 150 or x (30 x ... Licensee=/5943408001, 03 /29 /20 04 21 :20 :46 MST Questions or comments about this message: please call the Document Policy Group at 303-397 -22 95 I E C 26 9 -2 8b R 4 Ob23580 440 IEC Publication 26 9 -2 (Second edition ... High-voltagefuses P r 1: Current-limiting fuses at 28 2-1 (1994) 28 2 -2 (1995) Partie Coupe-circuit expulsion 28 2 -2 (1995) P r 2: Expulsion fuses at 28 2-3 (1976) Troisiốme partie: Diterminaticm du facteur...

Ngày tải lên: 25/12/2013, 10:53

... b0439 -2- ENGL 20 00 - 4844873 0 727 933 T B B - 39- 60439 -2 O IEC :20 00 8 .2. 10 .2. 1 The tests described in 8 .2. 10.1.1 shall be performed with the mass 8 .2. 10 .2. 2 The test described in 8 .2. 10.1 .2 shall ... 388 .2. 10 .2. 1 60439 -2 O CEI :20 00 L'essai décrit en 8 .2. 10.1.1 doit être exécuté avec une charge M=m+mL+QOkg 8 .2. 10 .2. 2 L'essai décrit en 8 .2. 10.1 .2 doit être exécuté avec une charge M = ml , 8 .2. 10.3 ... see IEC 60947 -2) COPYRIGHT International Electrotechnical Commission Licensed by Information Handling Services 4844893 0 727 900 32" STDeIEC b0439 -2- ENGL 20 00 -26 - 7.4 .2 60439 -2 O CEI :20 00 Protection...

Ngày tải lên: 25/12/2013, 11:05

... Report TR -20 06- 32, Charles University in Prague, 20 06 Mírovský J 20 06 Netgraph: a Tool for Searching in Prague Dependency Treebank 2. 0 In Proceedings of TLT 20 06, Prague, pp 21 1 -22 2 Rychlý P 20 00 ... Spain, 20 02 Clark J., DeRose S 1999 XML Path Language (XPath) http://www.w3.org/TR/xpath, 1999 Hajič J et al 20 06 Prague Dependency Treebank 2. 0 CD-ROM LDC2006T01, LDC, Philadelphia, 20 06 Hajičová ... California, USA, 20 05 Bird et al 20 06 Designing and Evaluating an XPath Dialect for Linguistic Queries In: Proceedings of the 22 nd International Conference on Data Engineering (ICDE), pp 52- 61, Atlanta,...

Ngày tải lên: 08/03/2014, 01:20

... Requirements Checklist GAO/AIMD-00 -21 .2. 3, March 20 00 Direct Loan System Requirements Checklist, GAO/AIMD-00 -21 .2. 6, April 20 00 Travel System Requirements Checklist, GAO/AIMD-00 -21 .2. 8, May 20 00 ... discounted 25 percent Orders should be sent to: U.S General Accounting Office P.O Box 37050 Washington, D.C 20 013 To order by Phone: Voice: TDD: Fax: (20 2) 5 12- 6000 (20 2) 5 12- 2537 (20 2) 5 12- 6061 ... from GAO, 700 4th Street NW, Room 1100, Washington DC 20 548, or by calling (20 2) 5 12- 6000 or TDD (20 2) 5 12- 2537 (193014) Page 26 GAO- 02- 248G – Title Standards Not Superceded by FASAB (11/01)...

Ngày tải lên: 15/03/2014, 16:20

... (1510–1545) GFP–MRP2 GFP–MRP2D7 GFP–MRP2D11 GFP–MRP2D15 GFP–MRP2D20 GFP–MRP2D25 GFP–MRP2D25 MAKE GFP–MRP2D50 GFP–MRP2D100 73 69 65 16 15 1 18 18 20 17 64 59 59 64 35 13 15 67 20 33 32 35 65 GKIIECGSPEELLQIPGPFYFMAKEAGIENVNSTKF ... jaundice in rats with a mutation in a Ó FEBS 20 02 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 multidrug resistance associated-protein gene Science 27 1, 1 126 – 1 127 Ito, K., Suzuki, H., Hirohashi, T., ... Time (days) % Apical % Vesicles % ER GFP–MRP2 4 70 81 77 71 2 21 11 55 47 54 47 78 69 69 63 11 12 22 36 45 38 47 20 28 29 35 GFP–MRP2D15 GFP–MRP2D25 ± ± ± ± ± ± ± ± ± ± ± ± 3 3 1 1 ± ± ± ± ±...

Ngày tải lên: 31/03/2014, 09:20

... 14.7  1.10  21 2  50  64.7  4.46  29 8  148  100  114.7  7.91  338  170  150  164.7  11.36  366  186  20 0  21 4.7  14.80  388  198  300  314.7  21 .70  422   21 7  600  614.7  42. 38  489  25 4  900  914.7  ... Section Waterside Problems 6 .2 Feedwater Contamination from Makeup Water 6.3 FW Contamination from Returning Condensate 6.4 Problems Associated with the Final Feedwater Blend 191 1 92 193 20 3 20 6 Waterside ... Efficiency 10 14 Boiler Types and Applications 2. 1 Electric Boilers 2. 2 Fire Tube (Shell) Boilers 2. 3 Water Tube Boilers 2. 4 Nuclear Reactor Boilers 23 24 29 39 61 Boiler Plant Subsystems, Appurtenances,...

Ngày tải lên: 02/04/2014, 15:21

... 5 .2. 2 .2. 2, 5 .2. 5 .2. 3 to 5 .2. 2 .2. 3, 5 .2. 5 .2. 4 to 5 .2. 2 .2. 4 and 5 .2. 5 .2. 5 to 5 .2. 2 .2. 5 5 .2. 2 .2. 2 Protected outputs Change the two paragraphs of the existing note to “NOTE 1” and “NOTE 2 Page 37 ... 5 .2. 5 .2 Add itio na1 requirements read: 5 .2. 2 .2 Add itio na1 requirements and change the numbering of the following five subclauses as follows: 5 .2. 5 .2. 1 to 5 .2. 2 .2. 1, 5 .2. 5 .2. 2 to 5 .2. 2 .2. 2, ... Resale, 02/ 12/ 2006 06:57:54 MST -6Page 51 Table 26 - Overload and short-circuit tests for digital outputs Replace, in the fifteenth line, ‘I .in 4 .2. 2 .2 and 4 .2. 3 .2 by ‘I .in 5 .2. 2 .2 and 5 .2. 3 .2 ...

Ngày tải lên: 04/04/2014, 12:14

... GW:1–10 ng/L, SW: 1 24 ng/L, WW: 1.4 29 ng/L MQL: 10 20 ng/L [27 ] MDL: 5 20 ng/L [24 ] 59– 92 [21 ] [26 ] Fate of Pharmaceuticals in the Environment and in Water Treatment Systems TABLE 2. 1 Methods for ... 100 RP-18, pH 2; MeOH © 20 08 by Taylor & Francis Group, LLC GW, SW, WW Limit of Detection and Quantification Ref [20 ] Deionized water: 80 MQL GW:10 ng/L WW: 25 25 0 ng/L IDL6: 12 32 ng/L LC-(+/–)ESI-MS/MS ... 2 3; MeOH LC-(+)ESI-MS/MS 72 99 MDL: 1–8 ng/L [44] LC-(+/–)ESI-MS/MS SPE: 58– 120 Freeze-drying: 54–1 02 MQLSPE: 2 5 ng/L MQLFreeze-drying: 20 –50 ng/L [46] LC-(+)-ESI-IT-MS GW: 51– 120 SW: 74– 127 ...

Ngày tải lên: 18/06/2014, 16:20

... delineation of open water features International Journal of Remote Sensing 17:1 425 –14 32 © 20 08 by Taylor & Francis Group, LLC An Expert System–Based Image Classification 19 Tan, Qulin 20 02 Study on remote ... located adjacent to waters or muddy beaches, with their elevations lower than surrounding forests and grasslands The normal water level of Poyang Lake fluctuates between 5.9 m and 22 .20 m seasonally ... normalized difference water index for remote sensing of vegetation liquid water from space Remote Sensing of Environment 58 :25 7 26 6 McFeeters, S K 1996 The use of the Normalized Difference Water Index...

Ngày tải lên: 18/06/2014, 16:20

... http://www.hqlo.com/content/7/1/91 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 patients with type diabetes mellitus JAMA 20 09, 301:1565-15 72 American Diabetes Association Workgroup ... (kg/m2) History of complications Macrovascular Microvascular Duration of diabetes, years 9 62. 7 (10.6) 42. 6% 57.4% 62. 8% 7 .24 (1 .23 ) 29 .1% 87.3 (15.8) 29 .6 (4.6) 28 .9% 16.4% 15.1% 24 .6% ... purposes) Health and Quality of Life Outcomes 20 09, 7:91 http://www.hqlo.com/content/7/1/91 25 .0 21 .6 20 .0 (+/- 16 .2) 15.0 12. 1 (+/- 12. 3) 10.0 6.0 5.0 (+/- 8 .2) 0.0 reported no episode of hypoglycaemia...

Ngày tải lên: 18/06/2014, 19:20

... section will © 20 01 by CRC Press LLC 40 30 20 Filter Head in Feet Fliter Particle Couns Head 10 16 6: 10 :0 14 :0 18 :0 19 :5 20 :0 20 :4 20 :4 22 :0 2: 00 6: 00 10 :0 12 :2 12 :2 12 :3 13 :0 13 ... range 40 L1306/frame/pt01 Page 22 Friday, June 23 , 20 00 1:45 PM 22 45 L1306/frame/pt01 Page 23 Friday, June 23 , 20 00 1:45 PM APPLICATIONS FOR DRINKING WATER TREATMENT 23 data are properly trended ... 50.00% 40.00% 1.5 30.00% 20 .00% 0.5 10.00% 0.00% Figure 2. 2 10 13 16 19 22 25 28 31 34 37 40 43 46 49 52 55 58 Log vs percent removal © 20 01 by CRC Press LLC % Scale Log Scale 2. 5 L1306/frame/pt01...

Ngày tải lên: 18/06/2014, 19:20

... Change 57 (20 03), pp .28 7-318 Morrison, J., Quick, M and Foreman, M.: Climate Change in the Fraser River Watershed: Flow and Temperature Projections Journal of Hydrology 26 3 (20 02) , pp .23 0 -24 4 Monteith, ... and a 20 % increase in precipitation could increase runoff by 29 % at the New Delhi station, whereas for Gauhati and Sylhet stations the expected changes are 22 % and 21 %, respectively 2. 4 .2 THE ... (19 92) , pp.1 -23 Quick, M C.: The UBC Watershed Model In: Computer Models of Watershed Hydrology (V P Singh ed.) Water Resources Publications, Highlands Ranch, Colorado, U.S.A., 1995, pp .23 3 -28 0...

Ngày tải lên: 18/06/2014, 19:20

... Hour m3 989 945 9 02 727 844 1164 1571 1600 1775 10 1964 11 20 66 12 2110 Hour m3 13 1600 14 1309 15 1091 16 945 17 10 62 18 1455 19 1745 20 21 39 21 21 10 22 20 37 23 1746 24 1018 © 20 06 Taylor & Francis ... Qavg(m3/h) Population 666.67 651.97 21 6.76 28 8.90 161.05 99.74 58.03 67.95 86 ,25 1 74 ,26 1 18,5 42 42, 149 22 ,156 9958 8517 12, 560 186 21 1 28 1 165 174 24 0 164 130 22 11.16 27 4,394 193 District District ... 86 ,25 1 A1 25 0 p1(%) c1(%) 37 100 23 100 10 100 0 100 0 0 26 40 74 ,26 1 A2ϭ185 p2(%) c2(%) 20 100 100 28 95 11 100 12 100 0 100 19 80 18,5 42 A3ϭ57 p3(%) c3(%) 10 100 18 100 100 0 0 42 100 0 27 ...

Ngày tải lên: 18/06/2014, 19:20

... American Vol 20 2, pp 55-63 Miller, R.; McQueen, I.; Branson, F.; Shown, L & Buller, W (1969) An Evaluation of Range Floodwater Spreaders Journal of Range Management Vol 22 , pp 24 6 -24 7 18 Water Conservation ... before CCC labor was available averaged $157 ( $2, 529 in 20 10) (Talbot, 1 926 ) This was for a dirt tank that would store an average capacity of 22 0 m3 of water It is assumed that the same basic stock ... Management, Vol 15, pp 22 0 -22 6 Prinz, D., and A.H Malik 20 02 Runoff Farming WCA InfoNet, Rome, Italy, 39 pp Rango, A.; Tartowski, S.; Laliberte, A.; Wainwright, J & Parsons, A (20 06) Islands of Hydrologically...

Ngày tải lên: 19/06/2014, 08:20