10 material identified with or produced to a specification not permitted by this section and material not fully identified pg 10 1 identified with complete certification from the material manufacturer

Tài liệu CHAPTER TwENTY ONE A BIOLOGICAL APPROACH TO A MODEL OF AESTHETIC ExPERIENCE OSHIN VARTANIAN AND MARcos NADAL pdf

Ngày tải lên : 19/02/2014, 17:20

... demonstrated that acllvtly m the orbital frontal cortex was greater for stimuli classified as beautiful, and the authors argued that this activation in the orbital frontal cortex was due to the reward ... date have tackled facets of aesthetic affect or emotion, and can thus shed light on whether variations in aesthetic emotion correspond to variations in cortical and subcortical activation Vartanian ... processing along all five stages of the model The results indicate that evaluating a stimulus as beautiful was asSOCIated WIth mcreased activation in the orbital frontal cortex Activation in the orbital...

9
598
0

Báo cáo y học: "Readmission to a surgical intensive care unit: incidence, outcome and risk factor" ppt

Ngày tải lên : 13/08/2014, 11:23

... ICU Acknowledgements The authors are grateful to Mr Florian Rissner and Dr Martin Specht for data mining and to Dr Karen Pickett for editorial assistance References 10 11 12 13 14 15 16 17 Cooper ... (54 .1) 18 7 (52.4) 38 (62.3) 15 (53.6) Duration, median and range (days) (1 to 5) (1 to 4) (1 to 4) (1 to 10 ) (1 to 5) 66 (13 .9) 54 (14 .2) 51 (13 .4) 12 (17 .9) (10 . 7) ICU LOS, median and range (days) ... (1. 02 to 1. 09) 0.0 01 1.03 (0.99 to 1. 07) 0 .13 8 SOFAmax 1. 06 (1. 03 to 1 .10 ) < 0.0 01 1.04 (1. 01 to 1. 08) 0.045 Mechanical ventilation during ICU stay 1. 04 (0.82 to 1. 31) 0.772 1. 05 (0.78 to 1. 41) ...

12
266
0

Tài liệu Báo cáo khoa học: Proteolysis of Pseudomonas exotoxin A within hepatic endosomes by cathepsins B and D produces fragments displaying in vitro ADP-ribosylating and apoptotic effects doc

Ngày tải lên : 18/02/2014, 04:20

... by cathepsin B and ⁄ or D within the ETA sequence at various pH values (Fig 4A, B) The proteolysis of ETA at pH or by cathepsin B and ⁄ or D was analyzed by reducing SDS ⁄ PAGE (Fig 4A) , and the ... GWEQLEQCGYPVQRLVALYLAARLSWNQVDQV IRNALASPGSGGDLGEAIREQPEQARLALTLAAAESERFVRQGTGNDEAGAANADVVSLTCP VAAGECAGPADSGDALLERNYPTGAEFLGDGGDVSFSTRGTQNWTVERLLQAHRQLEERGYV FVGYHGTFLEAAQSIVFGGVRARSQDLDAIWRGFYIAGDPALAYGYAQDQEPDARGRIRNGA ... analysis with the antibody against ETA revealed that the endosomal ETA-degrading activity was partially inhibited by the aspartic acid protease inhibitor pepstatin -A (PA), the cysteine protease...

15
588
0

Financial reporting under IFRS a topic based approach by wolfgang dick and franck missonier piera

Ngày tải lên : 04/03/2017, 11:52

... (i.e by looking at the commercial transactions) and then consider the balance sheet as a remainder, or to start from the balance sheet (i.e what wealth the company has generated and what are its ... purchases will not be consumed and remain as stock Therefore changes in inventories have to be taken into account The initial stock on 01/ 01/ 2008 was 16 ,000 and the year end stock on 12 / 31/ 2008 was ... accounting standards (IAS/IFRS), it is compulsory to publish at least one table dedicated to the analysis of each of these elements Sections 1. 1 .1 to 1. 1.3 explain the content and format of these tables,...

360
649
0

Verbal advantage 10 steps to a powerful vocabulary

Ngày tải lên : 25/10/2013, 23:59

... fretful and peevish are… strenuous and arduous are… personable and unbecoming are… resolute and wavering are… hypothesis and supposition are… arbitrary and rational are… varied and monotonous are… 10 ... have cost the company a lot of money.” Arbitrary comes from the same Latin source as the words arbiter (AHR-bi-tur) and arbitrator (AHR-bi-TRAY-tur) Arbiter and arbitrator both mean a judge or ... advocate of handgun control.” An advocate may also be a person who speaks for another, for example, a lawyer who pleads a case before a court To advocate means to support, plead for, defend by argument:...

489
995
3

Tài liệu Connecting to a Named Instance of SQL Server or Microsoft Data Engine (MSDE) docx

Ngày tải lên : 14/12/2013, 18:16

... are also shared The System.Data.SqlClient class cannot automatically discover the port number of a named instance of SQL Server listening on a port other than the default 14 33 To connect to a named ... running All other copies are named instances and are identified by the network name of the computer plus an instance name The format is \ This format is used in the connection ... Coordinator (DTC) and the Microsoft Search services are installed and used simultaneously by every installed instance of SQL Server Client tools such as Enterprise Manager and Query Analyzer are...

3
406
0

Tài liệu Lab 5.2.7 Establishing a Console Connection to a Router or Switch docx

Ngày tải lên : 21/12/2013, 19:15

... a or 25-pin male connector labeled serial or COM1 It may or may not be identified Step Locate the RJ-45 to DB-9 adapter One side of the adapter connects to the PCs serial interface and the other ... end of the rollover cable to the RJ-45 to DB-9 or DB-25 adapter Finally, attach the adapter to a PC serial port, either DB-9 or DB-25, depending on the computer Step Start the PC HyperTerminal program ... router or switch Step Locate or build a rollover cable Use a rollover cable If necessary, make one of adequate length to connect the router or switch to a workstation 2-6 CCNA 1: Networking Basics...

6
476
0

Tài liệu Seven Steps to a Successful Business Plan Chapter 10-11 ppt

Ngày tải lên : 26/01/2014, 15:20

... frayed but sanity and order prevailed as the Christmas season came and went by in candlelight for many families With some time and effort, reactions to these natural disasters can be planned and ... to information and can rally a worldwide resistance to a product Another thing to watch for: History is replete with examples of creeping into progress Today many appear humorous after the fact ... merit .12 It can be shaped, managed, and manipulated Probably the best use of company image is as a springboard to attract more customers and generate more profits For example, if you are an American,...

55
610
0

Tài liệu Báo cáo khoa học: Four divergent Arabidopsis ethylene-responsive element-binding factor domains bind to a target DNA motif with a universal CG step core recognition and different ﬂanking bases preference pptx

Ngày tải lên : 18/02/2014, 13:20

... site A 60 bp single-stranded DNA RDM10, with 10 randomized oligonucleotides in the center, i.e CTGTCAGTGAT GCATATGAACGAATN10AATCAACGACATTAGGATC CTTAGC was synthesized A 10 0 ng sample of RDM10 was ... of a three-stranded antiparallel b-sheet and an a- helix, packed approximately parallel to the b-sheet, with the seven thoroughly conserved amino acids (Arg6, Arg8, Trp10, Glu16, Arg18, Arg26 and ... binding assay of the ERF–DNA complex The binding complex of the ERFs and their binding DNAs were incubated together with 0, 0.0 01, 0. 01, 0 .1, 1. 0 and 10 lg poly[dAdT].poly[dA-dT] in a 10 lL volume and...

10
464
1

Tài liệu Mining Database Structure; Or, How to Build a Data Quality Browser docx

Ngày tải lên : 19/02/2014, 12:20

... 10 0 0 10 0 00 10 0 00 1E+06 1E+07 1E+08 Actual join size 1 10 10 0 10 0 0 10 0 00 10 0 00 1E+06 1E+07 1E+08 Actual join size 10 10 10 0 Estimated join size Estimated join size 10 0 10 0 0 10 0 00 10 0 000 10 0 0 10 0 00 ... 10 0 00 10 0 000 10 0 0 10 0 00 10 0 000 10 0 0000 10 0 00000 10 0 000000 10 0 0000 10 0 00000 Adjusted join size vs actual join size, 10 0 samples Unadjusted join size vs actual join size, 10 0 samples ộ ị ỉố ỗ õ ó ị ... )Ô@e5H$ÂƯ5F@$5@XUƯYÔFd)bFE5jkƯE$@e& Actual q-gram vector distance 0 0.2 0.4 0.6 0.8 1. 2 Estimated vs actual q-gram vector distance, 15 0 sketch samples 5.5 .1 Using Multiset Resemblance Actual q-gram vector distance 0 0.2...

12
581
0

The Sterling Bond Markets and Low Carbon or Green Bonds - A report to E3G ppt

Ngày tải lên : 06/03/2014, 08:20

... 11 0 4.2 France 65 2.5 Germany 61 4.2 Supra National 50 4 .1 Australia 31 0.9 Netherlands 31 1.0 Italy 30 1. 3 Ireland 25 0.9 Spain 20 0.8 Other 11 6 3.3 Total 10 6 2 10 0 .0 An alternative way to split the bonds is into sectors such as corporates (eg British Telecom, ... The quasi and foreign government sector (10 . 3%) is dominated by the EIB (3.5%) and KfW Bankengruppe (2.5%). The former is a supra‐national agency rated AAA and the latter a German government agency also rated AAA. The financial sector (predominantly banks and insurance companies) is more broadly spread but ... Brokers are the glue that brings together “issuers and investors” in the primary financial markets and “buyers and sellers” in the secondary markets. Rather than an investor having to find another investor to buy or sell bonds to, they go to a broker who purchases bonds immediately from them ...

38
503
1

SIMPLE OPEN ECONOMY MACRO WITH COMPREHENSIVE ACCOUNTING A RADICAL ALTERNATIVE TO THE MUNDELL FLEMING MODEL ppt

Ngày tải lên : 06/03/2014, 15:21

... together with consumption, imports, exports, wealth and its allocation between the available assets and the exchange rate are all endogenously determined When the exchange rate changes, this changes ... until all changes in stock and flow variables cease and the balance of trade reverts to zero Output in the # country has been permanently raised Fiscal policy and also monetary policy in the form ... Lattre and P Berger (eds), Monnaie et balance des paiements, Paris: Armand Colin, pp 89- 11 0 Branson, W.H and Henderson, D.W (19 85), The specification and influence of asset markets’, in R Jones and...

13
491
0

Báo cáo khoa học: Mechanism of mild acid hydrolysis of galactan polysaccharides with highly ordered disaccharide repeats leading to a complete series of exclusively odd-numbered oligosaccharides doc

Ngày tải lên : 23/03/2014, 04:21

... G -A- G -A- G -A- G -A- G -A- G -A- G -A- G G -A- G -A- G -A- G -A- G -A- G -A- G -A- G -A- G G -A- G-Aol G -A- G -A- G-Aol G -A- G -A- G -A- G-Aol G -A- G -A- G -A- G -A- G-Aol G -A- G -A- G -A- G -A- G -A- G-Aol G -A- G -A- G -A- G -A- G -A- G -A- G-Aol G -A- G -A- G -A- G -A- G -A- G -A- G -A- G-Aol ... 9 61. 3 12 67.3 15 73.4 18 79.5 218 5.0 24 91. 0 2797.2 11 13 15 17 10 12 14 16 18 G -A- G G -A- G -A- G G -A- G -A- G -A- G G -A- G -A- G -A- G -A- G G -A- G -A- G -A- G -A- G -A- G G -A- G -A- G -A- G -A- G -A- G -A- G G -A- G -A- G -A- G -A- G -A- G -A- G -A- G ... lambda-carrageenan by Pseudoalteromonas carrageenovora lambda-carrageenase: a new family of glycoside hydrolases unrelated to kappa- and iota-carrageenases Biochem J 404, 10 5 11 4 15 Caram-Lelham N (19 95)...

13
434
0

Báo cáo khoa học: The )148 to )124 region of c-jun interacts with a positive regulatory factor in rat liver and enhances transcription Dipali Sharma*, Sujata Ohri and Aparna Dixit ppt

Ngày tải lên : 23/03/2014, 20:22

... over a period of 30 and autoradiographed Afﬁnity puriﬁcation of the factor(s) interacting with the )14 8 to )12 4 region of c-jun This was carried out essentially as described by Kadonaga and Tjian ... reaction mixture was placed on ice and UV irradiated (254 nm) for 15 [25] Following irradiation, the mixture was separated by SDS/PAGE (15 % acrylamide) and analysed by autoradiography changes of · binding ... binds to the region )14 8 to )12 4 of c-jun and stimulates transcription Materials and methods Reagents and animals All chemicals were of reagent grade and were from Sigma Chemical Co unless stated...

9
449
0

Upgrading IBM Systems Director Server on Windows and migrating to a Microsoft SQL Server or Microsoft SQL Server Express database Version 6 Release 3 pptx

Ngày tải lên : 31/03/2014, 16:20

... default Apache Derby database to the default managed IBM DB2 database and then switch your database to a non-default database The upgrade process automatically migrates your Apache Derby database ... Admin_ID/Admin_PW@DB_name as sysdb Notes: v Admin_ID = the user ID for the Oracle® Database administrator v Admin_PW = the Oracle® Database administrator password v DB_Name = the name/SID of the database to which ... database user ID than the database administrator user ID The database user does not need as much authority to the database as the database administrator user v For detailed information about user IDs,...

66
600
0

10 steps to a results based monitoring and evaluation system

Ngày tải lên : 22/05/2014, 12:52

... Management, Maintenance, and Credibility 10 7 Key Criteria for Collecting Quality Performance Data 10 9 The Data Quality Triangle: Reliability 10 9 The Data Quality Triangle: Validity 11 0 The Data Quality ... minimum, the ability to successfully construct indicators; the means to collect, aggregate, analyze, and report on the performance data in relation to the indicators and their baselines; and managers ... The handbook will describe these steps in detail, the tasks needed to complete them, and the tools available to help you along the way Please also note the additional materials available in the...

268
2.8K
0

$báo cáo hóa học: " Is global quality of life reduced before fracture in patients with low-energy wrist or hip fracture? A comparison with matched controls" docx$

báo cáo hóa học: " Is global quality of life reduced before fracture in patients with low-energy wrist or hip fracture? A comparison with matched controls" docx

Ngày tải lên : 18/06/2014, 19:20

... Norway [ 21, 39- 41] The Cronbach's alpha in our study was 0.87 for the total score, 0.67 for the relationship and marital well-being score, 0.70 for the health and function score, and 0.76 for the ... interests Authors' contributions GR initiated this paper as a part of a larger study of fracture patients, collected and analyzed the data and wrote the manuscript GH was the principal investigator for ... the analyzes and drafting of the paper All authors critiqued revisions of the paper and approved the final manuscript Acknowledgements We appreciate the expert technical assistance and help with...

11
514
0

Báo cáo hóa học: " Validity and reliability of the Spanish version of the DN4 (Douleur Neuropathique 4 questions) questionnaire for differential diagnosis of pain syndromes associated to a neuropathic or somatic component" docx

Ngày tải lên : 18/06/2014, 22:20

... of to each negative item The total score is calculated as the sum of all 10 items, and the cut-off value for the diagnosis of neuropathic pain is a total score of 4 /10 All questions are related ... sensory and pain descriptors) are based on an interview with the patient, and items based on the clinical examination are related to the presence or absence of touch or pinprick hypoesthesia and ... Princesa, Madrid, Spain), Mar a Madariaga (Hospital de la Princesa, Madrid, Spain) and Carmen Martínez-Valero (Hospital Universitario, Virgen de las Nieves, Granada, Spain) for their collaboration...

10
532
0

báo cáo hóa học:" Physician-estimated disease severity in patients with chronic heart or lung disease: a cross-sectional analysis" ppt

Ngày tải lên : 20/06/2014, 15:20

... Acknowledgements This research was supported by grants from the Agency for Healthcare Research and Quality to Dr Wolinsky (R 01 HS -10 2 34) and Dr Wyrwich (K02 HS -11 635) References 10 11 12 13 14 15 16 Rumsfeld ... in acquisition and interpretation of data FDW conceptualized the rationale and design of the study and performed the statistical analysis All authors read and approved the final manuscript Acknowledgements ... ratio for a particular category, as well as for between-category changes, appear small in magnitude because the OR is for each 1- unit change Results were robust in that the same patient variables...

9
337
0