The offficial guide toefl test

+SER][LIVIJVSQLIVI ’ 83)*04VEGXMGI3RPMRI 8LI TVEGXMGIXIWXXLEX GERLIPT]SYKSER][LIVI +IXXLIVIEP83)*0 M&8 XIWXMRKI\TIVMIRGI -QTVSZI]SYVWOMPPWXSHE][MXLEYXLIRXMG83)*0M&8vXIWX UYIWXMSRWMRWXERXWGSVIWERHTIVJSVQERGIJIIHFEGOXLEX ]SYGERKIXSRP][MXL83)*0’4VEGXMGI3RPMRI 4VEGXMGIER][LIVIER]XMQI 4VEGXMGIMRGPEWWEXLSQISV[LIVIZIVXLIVIMWER-RXIVRIX GSRRIGXMSR h LSYVWEHE]WIZIRHE]WE[IIO 9WISRP]XLIFIWXXIWXTVIT 9WIXLISJwGMEPTVEGXMGIXIWXJVSQXLIGVIEXSVWSJ XLI83)*0 M&8 -XtWWMQTP]XLIFIWX[E]XSTVITEVI JSVWYGGIWWSRXIWXHE] +IXWXEVXIHRS[ :MWMX [[[IXWSVKXSIxTVEGXMGI ERHXEOIXLI SRITVEGXMGIXIWXXLEXGERLIPT]SYKSER][LIVI )87h0MWXIRMRK0IEVRMRK0IEHMRK’ 'ST]VMKLXF])HYGEXMSREP8IWXMRK7IVZMGI%PPVMKLXWVIWIVZIH)87XLI)87PSKS0-78)2-2+ 0)%62-2+0)%(-2+ERH83)*0EVIVIKMWXIVIHXVEHIQEVOWSJ)HYGEXMSREP8IWXMRK7IVZMGI )87 MRXLI 9RMXIH7XEXIWERHSXLIVGSYRXVMIW83)*0-&8MWEXVEHIQEVOSJ)87 The  Official  Guide  to  the  TOEFL®  Test   Practice  Tests   The  test  questions  on  these  files  are  from  actual  TOEFL  tests  However,  the  screen  and  delivery  formats   are  not  identical  to  the  actual  test  When  you  take  the  actual  TOEFL  test,  you  may  notice  some  variations   in  how  the  questions  are  presented  to  you  on  screen   Viewing  your  Interactive  TOEFL  iBT  Practice  Tests   To  view  your  TOEFL  iBT  Practice  Tests  1  and  2,  go  to  your  desktop  and  look  for  the  “TOEFL  Practice   Tests”  shortcut Changing  Regional  and  Language  Settings   Please  note:  If  you  encounter  error  messages  while  attempting  to  use  this  program,  you  may  need  to   adjust  your  computer’s  regional  and  language  settings  Please  follow  the  steps  listed:   Select  “Regional  and  Language  Options”  from  Control  Panel   Go  to  “Regional  Options”  tab   Select  “English  (United  States)”  as  the  language   Go  to  the  “Advanced”  tab   Select  “English  (United  States)”  as  the  language   Click  on  “OK”   Main  Menu  (“Navigation  Screen”)   This  screen  appears  as  follows:   Your  choice  will  depend  on  how  you  prefer   to  practice  for  the  TOEFL  iBT   If  you  want  to  take  full-­length  authentic   TOEFL  iBT  practice  tests  on  your   computer,  click  on  the  choices  labeled   TOEFL  iBT  Practice  Test  1  or TOEFL  iBT   Practice  Test  2 If  you  want  to  work  through  the  Practice   Sets  and  Practice  Tests  in  the  book,  click   on Play  Audio  Tracks  in  Book  Order Taking  TOEFL  iBT  Practice  Tests  on  Your  Computer   On  the  Navigation  screen,  choose  either  TOEFL  iBT  Practice  Test  1  or TOEFL  iBT  Practice  Test  2  Then   click  on  the  test  section  you  wish  to  take:  Reading,  Listening,  Speaking,  or Writing  Note  that  you  can   take  each  section  more  than  once  When  you  click  on  Reading,  you  can  choose  Passage  1,  2,  or  3   When  you  open  a  test  section,  you  will  first  see  the  instructions  for  that  section  A  timer  visible  on  the   screen  shows  how  many  minutes  and  seconds  you  have  left  for  that  section  (You  can  hide  the  timer  if   you  find  it  distracting.)   Click  on  Help  at  any  time  for  detailed  instructions  You  will  see  complete  explanations  for  each  function   available  during  the  test  and  how  to  use  those  functions  to  answer  each  question  type   If  you  must  take  a  break  during  the  test,  click  on  the  Break button  Your  work  will  not  be  lost,  and   when  you  resume,  you  will  take  up  exactly  where  you  left  off  The  timer  clock  will  stop  while  you  are  on   your  break  and  will  restart  immediately  when  you  resume  the  test  Try  not  to  use  the  Break  function  too   often  because  on  the  actual  exam,  the  clock  keeps  running  even  if  you  leave  the  room  on  a  break  To   resume  work  on  a  test,  click  on  Resume Answering  Questions   To  answer  the  questions,  click  on  the  corresponding  answer  oval,  or  follow  the  instructions  given  Once   you  select  an  answer,  the  Next  button  is  enabled  (For  some  questions,  you  will  need  to  click  on  more   than  one  answer  choice.)  Click  on  it  to  move  forward  to  the  next  question  (On  the  Reading  test,  you  can   also  click  on  the  Back  button  to  go  back  to  any  question  you  skipped  This  function  is  not  available  on  the   other  tests.)   When  all  the  questions  in  the  section  have  been  answered,  the  Finished button  will  be  enabled  Once   you  click  on  Finished,  the  test  ends   Playing  Audio  Tracks   On  the  Listening,  Speaking,  and  Writing  test  sections,  you  will  listen  to  audio  tracks  An  Audio  Control   bar  will  appear  on  the  screen  You  can  use  it  to  adjust  the  sound  volume  At  the  end  of  the  track,  click  on   Questions  to  start  answering  questions  On  the  Speaking  and  Writing  tests,  you  will  first  see  the   instructions  and  the  question,  then  you  will  click  on  Play  to  start  the  audio  track   Seeing  Your  Scores   On  the  Navigation  page,  click  on  Scoring  and  Review  You  will  be  able  to  see  your  results  for  any  test   section  that  you  have  completed  at  least  once  On  the  question  list  at  the  lower  right  corner  of  the  screen,   you  will  see  the  correct  answers  Explanations  are  available  for  Practice  Test  1  by  clicking  on  the  question   numbers  For  Reading  and  Listening,  a  chart  at  the  bottom  left  side  of  the  screen  shows  how  many   points  you  earned  for  answering  questions  correctly,  the  percentage  of  questions  that  you  answered   correctly,  and  how  much  of  the  total  time  available  you  used   Also  on  the  Navigation  page,  click  on  Compare  Test  Scores  You  will  see  bar  charts  that  plot  your   scores  from  trial  to  trial  for  both  the  Reading  and  the  Listening  tests   Working  Through  the  Practice  Sets  and  Practice  Tests  in  the  Book   On  the  Navigation  screen,  click  on  Play  Audio  Tracks  in  Book  Order  You  will  see  a  window  listing  audio   tracks  in  the  sequence  in  which  they  appear  in  the  book  As  you  work  through  the  Practice  Sets  and   Practice  Tests  in  the  book,  you  will  be  told  when  to  play  each  audio  track  Each  time  you  need  to  play  a   track,  you  will  see  the  following  symbol:   Click  on  the  number  of  the  track  as  instructed  in  the  book  Then  click  on  Play 8LI 3JJMGMEP+YMHI XSXLI ’ 8IWX 8LMVH )HMXMSR 1G+VE[,MPP 2I[=SVO`'LMGEKS`7ER*VERGMWGS`0MWFSR`0SRHSR`1EHVMH`1I\MGS'MX] 1MPER`2I[(IPLM`7ER.YER`7ISYP`7MRKETSVI`7]HRI]`8SVSRXS 'ST]VMKLXF]8LI1G+VE[,MPP'SQTERMIW-RG%PPVMKLXWVIWIVZIH)\GITXEWTIVQMXXIHYRHIVXLI9RMXIH7XEXIW'ST]VMKLX%GXSJRSTEVX SJXLMWTYFPMGEXMSRQE]FIVITVSHYGIHSVHMWXVMFYXIHMRER]JSVQSVF]ER]QIERWSVWXSVIHMREHEXEFEWISVVIXVMIZEPW]WXIQ[MXLSYXXLITVMSV[VMXXIR TIVQMWWMSRSJXLITYFPMWLIV -7&2 1,-(< 8LIQEXIVMEPMRXLMWI&SSOEPWSETTIEVWMRXLITVMRXZIVWMSRSJXLMWXMXPI-7&21,-( %PPXVEHIQEVOWEVIXVEHIQEVOWSJXLIMVVIWTIGXMZIS[RIVW 6EXLIVXLERTYXEXVEHIQEVOW]QFSPEJXIVIZIV]SGGYVVIRGISJEXVEHIQEVOIHREQI[IYWI REQIWMRERIHMXSVMEPJEWLMSRSRP]ERHXSXLIFIRIJMXSJXLIXVEHIQEVOS[RIV[MXLRSMRXIRXMSRSJMRJVMRKIQIRXSJXLIXVEHIQEVO;LIVIWYGLHIWMKRE XMSRWETTIEVMRXLMWFSSOXLI]LEZIFIIRTVMRXIH[MXLMRMXMEPGETW 1G+VE[,MPPI&SSOWEVIEZEMPEFPIEXWTIGMEPUYERXMX]HMWGSYRXWXSYWIEWTVIQMYQWERHWEPIWTVSQSXMSRWSVJSVYWIMRGSVTSVEXIXVEMRMRKTVSKVEQW8S GSRXEGXEVITVIWIRXEXMZITPIEWIIQEMPYWEXFYPOWEPIW$QGKVE[LMPPGSQ 8)6173*97) 8LMWMWEGST]VMKLXIH[SVOERH8LI1G+VE[,MPP'SQTERMIW-RG w1G+VE[,MPPx ERHMXWPMGIRWSVWVIWIVZIEPPVMKLXWMRERHXSXLI[SVO9WISJXLMW [SVOMWWYFNIGXXSXLIWIXIVQW)\GITXEWTIVQMXXIHYRHIVXLI'ST]VMKLX%GXSJERHXLIVMKLXXSWXSVIERHVIXVMIZISRIGST]SJXLI[SVO]SYQE]RSX HIGSQTMPI HMWEWWIQFPI VIZIVWI IRKMRIIV VITVSHYGI QSHMJ] GVIEXI HIVMZEXMZI [SVOW FEWIH YTSR XVERWQMX HMWXVMFYXI HMWWIQMREXI WIPP TYFPMWL SV WYFPMGIRWIXLI[SVOSVER]TEVXSJMX[MXLSYX1G+VE[,MPPvWTVMSVGSRWIRX=SYQE]YWIXLI[SVOJSV]SYVS[RRSRGSQQIVGMEPERHTIVWSREPYWIER]SXLIV YWISJXLI[SVOMWWXVMGXP]TVSLMFMXIH=SYVVMKLXXSYWIXLI[SVOQE]FIXIVQMREXIHMJ]SYJEMPXSGSQTP][MXLXLIWIXIVQW 8,);36/-7463:-()(w%7-7x1G+6%;,-00%2(-870-')273671%/)23+9%6%28))736;%66%28-)7%7838,)%''9 6%'= %()59%'= 36 '3140)8)2)77 3* 36 6)79087 83 &) 3&8%-2)( *631 97-2+ 8,) ;36/ -2'09(-2+ %2= -2*361%8-328,%8'%2&)%'')77)(8,639+,8,);36/:-%,=4)60-2/3638,)6;-7)%2()