0
  1. Trang chủ >
  2. Giáo Dục - Đào Tạo >
  3. Cao đẳng - Đại học >

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 4

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 1

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 1

... ANALYSIS OF REGULATOR OF G- PROTEIN SIGNALING (RGS) FUNCTION IN GROWTH, DEVELOPMENT AND PATHOGENICITY OF MAGNAPORTHE GRISEA HAO LIU A THESIS SUBMITTED FOR THE DEGREE OF DOCTOR OF PHILOSOPHY ... yeast…………………………………………… 22 1. 2.2.3 G proteins in mammals………………………………………… 23 1. 2.3 Desensitization of G protein Signaling ………………………… …… 24 1. 2.3 .1 The discovery of Regulator of G- protein signaling (RGS) ……24 1. 2.3.2 ... of G protein signaling (RGS), leads to the replacement of GTP with GDP and reassociation of G with G γ heterodimer, leading to the termination of G protein- mediated signaling (Figure 3) 1. 2.2...
  • 220
  • 228
  • 0
Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 2

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 2

... HPH1 RGS1 Figure 21 A rgs1D WT Rgs1 OP Complemented B WT rgs1D Complemented Rgs1 OP _ Figure 22 Inductive Non-inductive _ Figure 23 WT rgs1D Complemented Figure 24 Figure 25 Figure 26 Rgs1 MG00990 ... FlbA Sst2 467 27 2 479 466 QQDRSHIQQFPGCQVFQPTKHAIYHMTSKGKDMINGSVPRGRASEGDATHSATHRHG-VA QQDRAYTAQYPGSQLFQPTKHSIYQITPNGKDLINGMNSRGRTSDAESTPRDHKPNEKLP QEDKGYPQPDASIVVFQPSKYAIYGITERGQRVCG -WIARDKSRETFYDNRGMP ... ESPRNTMQLVNLERDTETDKLSHDRATIEVIFRRFAGQDGPNVKSSISTSDSDSLSDYSN FQISRSSFFTLSKRGWDLVSWTGCKSNNIRAPNGSTIDLDFTLRGHMTVRDEKKTLDDSE Rgs1 Cprgs-1 FlbA Sst2 408 21 3 420 406 GLTGVKMAPERKVNGKIHKDTFTGK-AASEWLMDCCTTVDRREAVEIASLFVEYELIEAL GLTGVKMAAERKIGGKTYKETFTGK-AATDWLMDCSTTVDRRETVEIASYFVEFGLMECV...
  • 12
  • 185
  • 0
Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 3

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 3

... Figure 28 Inductive Non-inductive _ Figure 29 Figure 30 Inductive Non-inductive _ Figure 31 B A Figure 32 A B Figure 33 A B Figure 34 mgb1D WT _ rgs1Dmgb1D magB G1 83Smgb1D Figure 35 Figure 36 ... mgb1D WT _ rgs1Dmgb1D magB G1 83Smgb1D Figure 35 Figure 36 MG01 031 5 MG010105 MG09 134 Control: Gamma actin MG 039 82 MG011 73 MG01 630 Figure 37 A B ...
  • 11
  • 227
  • 0
Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 4

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 4

... Figure 39 WT rgs1D Figure 40 Figure 41 Figure 42 _ Figure 43 - Gd + Gd, 1h + Gd, 0h + Gd, 2h + Gd, 0.5h + Gd, 3h _ Figure 44 A WT rgs1D Solvent Solvent 10mM 8-Br-cAMP 10mM 8-Br-cAMP _ B WT rgs1D ... Solvent 10mM 8-Br-cAMP 10mM 8-Br-cAMP _ B WT rgs1D Figure 45 Appressorium formation on inductive membrane (%) Appressorium formation on Noninductive membrane (%) WT 89 1.5 mscL∆ 92 mscS1∆ 87 2.5 ... mscS1∆ 87 2.5 mscS2∆ 91 mscS3∆ 85 mscL∆mscS1∆ 86 mscL∆mscS2∆ 92 1.5 mscL∆mscS3∆ 88 mscS1∆mscS2∆ 84 mscS1∆mscS3∆ 85 mscS2∆mscS3∆ 89 ...
  • 9
  • 180
  • 0
Báo cáo khoa học: Construction of a novel detection system for protein–protein interactions using yeast G-protein signaling pdf

Báo cáo khoa học: Construction of a novel detection system for protein–protein interactions using yeast G-protein signaling pdf

... AAACGCCTTCGCCCAAAGTTTAAAAGATGA TCATCTTTTAAACTTTGGGCGAAGGCGTTT TTTTCTCGAGAAAGATGCCGATTTGGGCGC GGGGCTCGAGGTTTTATATTTGTTGTAAAA ATATTATATATATATATAGGGTCGTATATA AAATTATAGAAAGCAGTAGA TAAAACAATG CTTCGAAGAATATACTAAAAAATGAGCAGG ... GCCCGTCGACATATTATATATATATATAGG CCCGCTCGAGTCTTAGAATTATTGAGAACG GCCCGGATCCTGATAGTAATAGAATCCAAA CCCCGAATTCAAATTATAGAAAGCAGTAGA AAGGCTCGAGAGATCTGTTTAGCTTGCCTC AAAAGTCGACGAGCTCGTTTTCGACACTGG TTTTGTCGACATGGCGCAACACGATGAAGC ... TTTTGTCGACATGGCGCAACACGATGAAGC CGTAGACAAC GGGGGGATCCTTACATAAGCGTACAACAAA CACTATTTGATTTCGGCGCCTGAGCATCA TTTAGCTTTTT ATCCAAAGTTTAGCCGATGACCCAAGCCAA TTGGCTTGGGTCATCGGCTAAACTTTGGAT AAACGCCTTCGCCCAAAGTTTAAAAGATGA...
  • 9
  • 444
  • 0
Tài liệu Báo cáo khoa học: Regulators of G-protein signalling are modulated by bacterial lipopeptides and lipopolysaccharide pptx

Tài liệu Báo cáo khoa học: Regulators of G-protein signalling are modulated by bacterial lipopeptides and lipopolysaccharide pptx

... RGS are modulated by lipopeptides and LPS S Riekenberg et al to the number and length of their fatty acids and the amino acid sequence of their peptide tail To address TLR2 ⁄ 1- and TLR2 ... modulation of RGS1 and RGS2 in BMDM after stimulation with LP and LPS in more detail, because regulation of RGS1 and RGS2 after activation of different TLR may modify the effects of G-protein signalling ... et al RGS are modulated by lipopeptides and LPS Relative expression of RGS1 mRNA Fig Expression of RGS1, RGS2 and TNFa mRNA in J774 After stimulation with 100 ngÆmL)1 LPS, 100 nM FSL-1 and 100...
  • 11
  • 569
  • 0
Báo cáo khoa học: The study of G-protein coupled receptor oligomerization with computational modeling and bioinformatics doc

Báo cáo khoa học: The study of G-protein coupled receptor oligomerization with computational modeling and bioinformatics doc

... and the selection of the sequences in the alignment determine the nature of the answers returned by the application of the computational tools The statistical nature of these tools makes their ... comparing the results of all these methods is beyond the scope of this review The main features of the approach are illustrated here for the combination of the Level Entropy method and the SequenceSpace ... counting the position relative to the most conserved residue in the particular TM The conserved locus is assigned the number 50, and the N2 values of the other loci decrease towards the N-terminus and...
  • 13
  • 515
  • 0
Báo cáo khoa học: Differential tissue-specific distribution of transcripts for the duplicated fatty acid-binding protein 10 (fabp10) genes in embryos, larvae and adult zebrafish (Danio rerio) docx

Báo cáo khoa học: Differential tissue-specific distribution of transcripts for the duplicated fatty acid-binding protein 10 (fabp10) genes in embryos, larvae and adult zebrafish (Danio rerio) docx

... show differential tissue-specific distribution of fabp10a and fabp10b transcripts in developing and adult zebrafish, evidence of the divergence of regulatory elements in the promoters of the fabp10a ... vesicles indicates a potential role for this protein in the early development of the zebrafish brain Tissue-specific distribution of fabp10b gene transcripts in adult zebrafish The tissue-specific distribution ... transcripts in embryos, larvae and adult zebrafish show strikingly different tissue-specific patterns of distribution On the basis of the distribution of fabp10b transcripts in many tissues of adult zebrafish, ...
  • 11
  • 402
  • 0
MULTI - SCALE INTEGRATED ANALYSIS OF AGROECOSYSTEMS - CHAPTER 4 docx

MULTI - SCALE INTEGRATED ANALYSIS OF AGROECOSYSTEMS - CHAPTER 4 docx

... © 20 04 by CRC Press LLC 84 Multi- Scale Integrated Analysis of Agroecosystems FIGURE 4. 4 Different ways of legitimizing systems of control (hierarchies of power) within human societies 4. 4a).This ... longer one of accredited experts discovering “true facts” for the determination FIGURE 4. 1 Postnormal science © 20 04 by CRC Press LLC 74 Multi- Scale Integrated Analysis of Agroecosystems of “good ... space-time window of relevant patterns to be considered); that is, large -scale scenarios must forget about the ceteris © 20 04 by CRC Press LLC 80 Multi- Scale Integrated Analysis of Agroecosystems...
  • 21
  • 315
  • 0
Mathematical and computational analysis of intracelluar dynamics 4

Mathematical and computational analysis of intracelluar dynamics 4

... damped oscillations of p53 and MDM2 protein levels in cell populations of mouse fibroblasts and human breast cancer epithelial MCF-7 cells, following 5Gy of IR The dynamics of the p53-MDM2 oscillator ... populations of human wild-type and Bloom’s syndrome patients’ fibroblast, following induction of DNA damage either by 20 J/m2 of UV radiation or 2.5 Gy of ionizing radiation (IR) ... following: periods of oscillation are to hrs; peaks of MDM2 oscillations lag behind p53 peak for 1.5 to 2.5 hrs; periods of oscillations decrease with increasing IR intensity; and peaks of p53 pulses...
  • 7
  • 190
  • 0
Functional interactions of protein tyrosine phosphatase alpha (PTPa) and src in mouse development and integrin singaling  investigation of double PTPa src deficient mice and cells

Functional interactions of protein tyrosine phosphatase alpha (PTPa) and src in mouse development and integrin singaling investigation of double PTPa src deficient mice and cells

... Functional Interactions of Protein Tyrosine Phosphatase Alpha (PTPα) and Src in Mouse Development and Integrin Signaling: Investigation of Double PTPα /Src- Deficient Mice and Cells CHEN MIN ... integrin signaling, and plays a negative feedback role in orchestrating integrin signaling To determine how PTPα is regulated upon integrin stimulation and how a signal emanating from integrin ... Phosphorylation of PTPα at Ser180 and Ser204 reduces the affinity of Grb2 SH2 binding to phospho-Tyr789 of PTPα without reducing the affinity of Src SH2 binding, resulting in less Grb2 and more Src binding...
  • 215
  • 341
  • 0
Tài liệu Báo cáo khoa học: Inorganic pyrophosphatase in the roundworm Ascaris and its role in the development and molting process of the larval stage parasites doc

Tài liệu Báo cáo khoa học: Inorganic pyrophosphatase in the roundworm Ascaris and its role in the development and molting process of the larval stage parasites doc

... that the hypodermis of the body wall, which synthesizes components of the cuticle, may offer a useful target for studies into the mechanism of the development and molting process in the roundworms ... presence of increasing concentrations of inhibitors for 10 days, and the number of molting larvae was determined Molting was manifested by shedding of the L3 cuticle Results Identification of cDNA ... involved in the molting process, we examined the effects of two PPase specific inhibitors, imidodiphosphate (IDP, 1-0631; Sigma) and NaF on development and molting of A suum lungstage L3 to fourth-stage...
  • 13
  • 691
  • 0
Báo cáo Y học: Progestin upregulates G-protein-coupled receptor 30 in breast cancer cells pot

Báo cáo Y học: Progestin upregulates G-protein-coupled receptor 30 in breast cancer cells pot

... Surprisingly, however, the protein synthesis inhibitor cycloheximide did not abolish the induction, which suggested that GPR30 is directly regulated by progestins We were not able to locate any progestin ... expressed in MCF-7 cells relatively late, although in a progestindependent manner, we decided to investigate whether MAPK activation is responsible for GPR30 mRNA regulation by progestin Progestin-induced ... display analysis Progestins upregulate GPR30 mRNA in MCF-7 breast cancer cells Northern-blot analysis was used to confirm the MPAdependent regulation and to study the steroid specificity of GPR30...
  • 6
  • 425
  • 0
Báo cáo lâm nghiệp:

Báo cáo lâm nghiệp: "in leaf development and thesis of Prunus serotina seedlings" doc

... Photosynthetic rates of other Prunus species all showed rates and developmental patterns similar to those of black cherry for both growth chamber and field measurements (Andersen and Brodbeck, 1988; ... Results All of the models tested to predict leaf area from various combinations of leaf length and width had good correlations and significant regressions Several models explained 97% or more of the ... leaf resistance, leaf water potential, and photosynthesis of non-bearing prune trees J Am Soc Hortic t> Sci 106, 216-21 Larson P.R & isebrands J.G (1971) The plastochron index as applied to developmental...
  • 3
  • 376
  • 0

Xem thêm

Từ khóa: Nghiên cứu sự hình thành lớp bảo vệ và khả năng chống ăn mòn của thép bền thời tiết trong điều kiện khí hậu nhiệt đới việt namNghiên cứu tổ chức pha chế, đánh giá chất lượng thuốc tiêm truyền trong điều kiện dã ngoạiGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANPhối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọTrả hồ sơ điều tra bổ sung đối với các tội xâm phạm sở hữu có tính chất chiếm đoạt theo pháp luật Tố tụng hình sự Việt Nam từ thực tiễn thành phố Hồ Chí Minh (Luận văn thạc sĩ)Nghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000Tìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tinThơ nôm tứ tuyệt trào phúng hồ xuân hươngChuong 2 nhận dạng rui roTổ chức và hoạt động của Phòng Tư pháp từ thực tiễn tỉnh Phú Thọ (Luận văn thạc sĩ)Quản lý nợ xấu tại Agribank chi nhánh huyện Phù Yên, tỉnh Sơn La (Luận văn thạc sĩ)Tăng trưởng tín dụng hộ sản xuất nông nghiệp tại Ngân hàng Nông nghiệp và Phát triển nông thôn Việt Nam chi nhánh tỉnh Bắc Giang (Luận văn thạc sĩ)BÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘIĐổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt namHIỆU QUẢ CỦA MÔ HÌNH XỬ LÝ BÙN HOẠT TÍNH BẰNG KIỀMTÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲQUẢN LÝ VÀ TÁI CHẾ NHỰA Ở HOA KỲ