... ANALYSIS OF REGULATOR OF G- PROTEIN SIGNALING (RGS) FUNCTION IN GROWTH, DEVELOPMENT AND PATHOGENICITY OF MAGNAPORTHE GRISEA HAO LIU A THESIS SUBMITTED FOR THE DEGREE OF DOCTOR OF PHILOSOPHY ... yeast…………………………………………… 22 1. 2.2.3 G proteins in mammals………………………………………… 23 1. 2.3 Desensitization of G protein Signaling ………………………… …… 24 1. 2.3 .1...
Ngày tải lên: 14/09/2015, 09:13
... HPH1 RGS1 Figure 21 A rgs1D WT Rgs1 OP Complemented B WT rgs1D Complemented Rgs1 OP _ Figure 22 Inductive Non-inductive _ Figure 23 WT rgs1D Complemented Figure 24 Figure 25 Figure 26 Rgs1 MG00990 ... FlbA Sst2 467 27 2 479 466 QQDRSHIQQFPGCQVFQPTKHAIYHMTSKGKDMINGSVPRGRASEGDATHSATHRHG-VA QQDRAYTAQYPGSQLFQPTKHSIYQITPNGKDLINGMNSRGRTSDAESTPRDHKPNEKLP QEDKGYPQPDASIVVFQPSKYAIYGITERGQRVCG -W...
Ngày tải lên: 14/09/2015, 09:24
Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 3
... Figure 28 Inductive Non-inductive _ Figure 29 Figure 30 Inductive Non-inductive _ Figure 31 B A Figure 32 A B Figure 33 A B Figure 34 mgb1D WT _ rgs1Dmgb1D magB G1 83Smgb1D Figure 35 Figure 36 ... mgb1D WT _ rgs1Dmgb1D magB G1 83Smgb1D Figure 35 Figure 36 MG01 031 5 MG010105 MG09 134 Control: Gamma actin MG 039 82 MG011 73 MG01 630 Figure 37 A B
Ngày tải lên: 14/09/2015, 09:39
Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 4
... Figure 39 WT rgs1D Figure 40 Figure 41 Figure 42 _ Figure 43 - Gd + Gd, 1h + Gd, 0h + Gd, 2h + Gd, 0.5h + Gd, 3h _ Figure 44 A WT rgs1D Solvent Solvent 10mM 8-Br-cAMP 10mM 8-Br-cAMP _ B WT rgs1D ... Solvent 10mM 8-Br-cAMP 10mM 8-Br-cAMP _ B WT rgs1D Figure 45 Appressorium formation on inductive membrane (%) Appressorium formation on Noninductive membrane (%) WT 89 1.5 mscL∆ 92 mscS1∆ 87...
Ngày tải lên: 14/09/2015, 09:53
Báo cáo khoa học: Construction of a novel detection system for protein–protein interactions using yeast G-protein signaling pdf
... AAACGCCTTCGCCCAAAGTTTAAAAGATGA TCATCTTTTAAACTTTGGGCGAAGGCGTTT TTTTCTCGAGAAAGATGCCGATTTGGGCGC GGGGCTCGAGGTTTTATATTTGTTGTAAAA ATATTATATATATATATAGGGTCGTATATA AAATTATAGAAAGCAGTAGA TAAAACAATG CTTCGAAGAATATACTAAAAAATGAGCAGG ... GCCCGTCGACATATTATATATATATATAGG CCCGCTCGAGTCTTAGAATTATTGAGAACG GCCCGGATCCTGATAGTAATAGAATCCAAA CCCCGAATTCAAATTATAGAAAGCAGTAGA AAGGCTCGAGAGATCTGTTTAGCTTGCCTC AAAAGTCGACGAGCTCGT...
Ngày tải lên: 16/03/2014, 01:20
Tài liệu Báo cáo khoa học: Regulators of G-protein signalling are modulated by bacterial lipopeptides and lipopolysaccharide pptx
... RGS are modulated by lipopeptides and LPS S Riekenberg et al to the number and length of their fatty acids and the amino acid sequence of their peptide tail To address TLR2 ⁄ 1- and TLR2 ... modulation of RGS1 and RGS2 in BMDM after stimulation with LP and LPS in more detail, because regulation of RGS1 and RGS2 after activation of different TLR may modify the e...
Ngày tải lên: 18/02/2014, 13:20
Báo cáo khoa học: The study of G-protein coupled receptor oligomerization with computational modeling and bioinformatics doc
... and the selection of the sequences in the alignment determine the nature of the answers returned by the application of the computational tools The statistical nature of these tools makes their ... comparing the results of all these methods is beyond the scope of this review The main features of the approach are illustrated here for the combination...
Ngày tải lên: 16/03/2014, 22:20
Báo cáo khoa học: Differential tissue-specific distribution of transcripts for the duplicated fatty acid-binding protein 10 (fabp10) genes in embryos, larvae and adult zebrafish (Danio rerio) docx
... show differential tissue-specific distribution of fabp10a and fabp10b transcripts in developing and adult zebrafish, evidence of the divergence of regulatory elements in the promoters of the fabp10a ... vesicles indicates a potential role for this protein in the early development of the zebrafish brain Tissue-specific distribution of fabp10b ge...
Ngày tải lên: 16/03/2014, 00:20
MULTI - SCALE INTEGRATED ANALYSIS OF AGROECOSYSTEMS - CHAPTER 3 pps
... generation of a lock-in of a larger -scale problem) Unfortunately, we can never know this type of information ahead of time © 2004 by CRC Press LLC 57 58 Multi- Scale Integrated Analysis of Agroecosystems ... Multi- Scale Integrated Analysis of Agroecosystems they require an implicit step of realization to be preserved as types.This explains the existence of...
Ngày tải lên: 11/08/2014, 21:21
Mathematical and computational analysis of intracelluar dynamics 3
... Sections 3. 3 and 3. 4 Finally, novel systemic behaviors of the system are inferred and predicted from the simulation results (Sections 3. 5 and 3. 6) 34 3. 2 Formulation of kinetic models Figure 3- 1 Kinetic ... p 53] n1 k [ p 53] v3 = j3n1 + [ p 53] n1 v4 = k [PIP 2] k {[PIPT ] − [PIP3]} = j + [PIP 2] j + [PIPT ] − [PIP3] vm = k m [PTEN ][PIP 3] j m + [PIP3] (3- 3) k [ p 5...
Ngày tải lên: 11/09/2015, 16:05
Functional interactions of protein tyrosine phosphatase alpha (PTPa) and src in mouse development and integrin singaling investigation of double PTPa src deficient mice and cells
... Functional Interactions of Protein Tyrosine Phosphatase Alpha (PTPα) and Src in Mouse Development and Integrin Signaling: Investigation of Double PTPα /Src- Deficient Mice and Cells CHEN MIN ... integrin signaling, and plays a negative feedback role in orchestrating integrin signaling To determine how PTPα is regulated upon integrin stimulat...
Ngày tải lên: 14/09/2015, 12:02
Role of multidrug resistance associated protein 4 (MRP4 ABCC4) in the resistance and toxicity of oxazaphosphorines
... resistance profiles of MRP4/ABCC4 to oxazaphosphorines including CP and IF in the absence and presence of various MRP4/ABCC4 inhibitors or MRP4/ABCC4 inducers by using the MRP4/ABCC4 overexpressing HepG2 ... interesting to investigate the effect of the combination of oxazaphosphorines and -x- MRP4/ABCC4 inhibitors on cancer treatment, and to investigate the e...
Ngày tải lên: 14/09/2015, 14:06
Tài liệu Báo cáo khoa học: Inorganic pyrophosphatase in the roundworm Ascaris and its role in the development and molting process of the larval stage parasites doc
... that the hypodermis of the body wall, which synthesizes components of the cuticle, may offer a useful target for studies into the mechanism of the development and molting process in the roundworms ... presence of increasing concentrations of inhibitors for 10 days, and the number of molting larvae was determined Molting was manifested by shedding of...
Ngày tải lên: 20/02/2014, 11:20
Báo cáo Y học: Progestin upregulates G-protein-coupled receptor 30 in breast cancer cells pot
... Surprisingly, however, the protein synthesis inhibitor cycloheximide did not abolish the induction, which suggested that GPR30 is directly regulated by progestins We were not able to locate any progestin ... expressed in MCF-7 cells relatively late, although in a progestindependent manner, we decided to investigate whether MAPK activation is responsible for GPR30 mRNA regulation by p...
Ngày tải lên: 24/03/2014, 00:21