colloidal silica transport mechanisms for passive site stabilization of liquefiable soils

Tài liệu Universal Transport Platform for Access Networks doc

Tài liệu Universal Transport Platform for Access Networks doc

... 32PNY16-OCU-1250s,32PNY16-ONT-1250s,and2PNY16-RN PNY16-16R-1250 Ordering Information 2/08ã104743AE PON Express 16 PON Express 16 Universal Transport Platform for Access Networks 2 www.adc.com • +1-952-938-8080 • 1-800-366-3891 λ λ Residential FTTC ENET/VDSL GPON/EPON FTTH FTTN Passive Remote ... Triple-play with dedicated 100Mbps to 1Gbps to the home PON Express 1...

Ngày tải lên: 17/01/2014, 11:20

4 274 0
Tài liệu Mechanisms for Knowledge Management Systems Effectiveness: An Exploratory Analysis pptx

Tài liệu Mechanisms for Knowledge Management Systems Effectiveness: An Exploratory Analysis pptx

... ARTICLE Knowledge and Process Management 212 H. Benbya and N. A. Belbaly & Research Article Mechanisms for Knowledge Management Systems Effectiveness: An Exploratory Analysis Hind Benbya* and ... 1999. Knowledge- based systems and knowledge management: friends or foes? Informa- tion and Management 35(2): 113–126. Janz DB, Prasarnphanich P. 2003. Understandin...

Ngày tải lên: 24/01/2014, 00:20

14 517 0
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... T m value of each protein at neutral pH. a Data from this study. b Data from Griffin et al. [32]. c Data from Yano et al. [4]. T. Mandai et al. Thermostable electron transport...

Ngày tải lên: 18/02/2014, 08:20

14 617 0
Tài liệu Báo cáo khoa học: Different mechanisms for cellular internalization of the HIV-1 Tat-derived cell penetrating peptide and recombinant proteins fused to Tat docx

Tài liệu Báo cáo khoa học: Different mechanisms for cellular internalization of the HIV-1 Tat-derived cell penetrating peptide and recombinant proteins fused to Tat docx

... Tat cell penetrating peptide uptake (Eur. J. Biochem. 269) 501 Different mechanisms for cellular internalization of the HIV-1 Tat- derived cell penetrating peptide and recombinant proteins fused ... internalization of the full-length Tat protein construct and the Tat CPP Differences in the mechanisms of internalization between t...

Ngày tải lên: 21/02/2014, 03:20

8 485 0
Mechanisms for delayed density-dependent reproductive traits in field voles, Microtus agrestis: the importance of inherited environmental effects doc

Mechanisms for delayed density-dependent reproductive traits in field voles, Microtus agrestis: the importance of inherited environmental effects doc

... reproduce in the increase-area sample (Table 2). Breeding performance of the overwintered generation Frequency and timing of breeding in the lab In the laboratory as in the field, the overwintered animals ... Copenhagen 2001 Mechanisms for delayed density-dependent reproductive traits in field voles, Microtus agrestis: the importance of...

Ngày tải lên: 05/03/2014, 17:20

13 503 0
Adapting to Web Standards: CSS and Ajax for Big Site pot

Adapting to Web Standards: CSS and Ajax for Big Site pot

... cells. F . Table artwork gaps are easily fixed with a little CSS. Adapting to Web Standards: CSS and Ajax for Big Sites Christopher Schmitt Kimberly Blessing Rob Cherny Meryl K. Evans Kevin Lawver Mark ... Cherny, Meryl K. Evans, Kevin Lawver, and Mark Trammell CSS and Ajax for Big Sites 18 ADAPTING TO WEB STANDARDS C   H...

Ngày tải lên: 05/03/2014, 17:20

298 586 0
Báo cáo khoa học: Differential effects of RU486 reveal distinct mechanisms for glucocorticoid repression of prostaglandin E2 release docx

Báo cáo khoa học: Differential effects of RU486 reveal distinct mechanisms for glucocorticoid repression of prostaglandin E2 release docx

... Differential effects of RU486 reveal distinct mechanisms for glucocorticoid repression of prostaglandin E 2 release Joanna E. Chivers 1 , Lisa M. Cambridge 1 , ... and RU486 (< 1 l M ) was without significant effect. Thus, two pharmacologically distinct mechanisms of glucocorticoid- dependent repression of prostaglandin E 2 release are revealed. Fir...

Ngày tải lên: 07/03/2014, 16:20

11 527 0
The Report of the Task Force on Financial Mechanisms for ICT for Development - A review of trends and an analysis of gaps and promising practices ppt

The Report of the Task Force on Financial Mechanisms for ICT for Development - A review of trends and an analysis of gaps and promising practices ppt

... - the European Bank for Reconstruction and Development (EBRD) - the Asian Development Bank (ADB) - the African Development Bank (AFDB) - the Inter-American Development Bank (IADB) and - the ... the Netherlands, Development Bank of Southern Africa and DEG of Germany) and US$120-million of senior debt from commercial banks (Barclays Ba...

Ngày tải lên: 15/03/2014, 19:20

125 1,3K 0
Making Things Move DIY Mechanisms for Inventors, Hobbyists, and Artists

Making Things Move DIY Mechanisms for Inventors, Hobbyists, and Artists

... tools A tape measure for large things, a metal ruler for small things and to use as a cutting edge, and a caliper for even smaller things. I recommend a digital caliper for ease of use (SparkFun ... the spoon or fork to the bottom-center dowel so that it can pivot when the duct tape roll falls and hits it. 28 Making Things Move M echanical systems come in many shapes...

Ngày tải lên: 16/03/2014, 22:05

369 780 0
Báo cáo khoa học: H NMR study of the molecular structure and magnetic properties of the active site for the cyanomet complex of O2-avid hemoglobin from the trematode Paramphistomum epiclitum pdf

Báo cáo khoa học: H NMR study of the molecular structure and magnetic properties of the active site for the cyanomet complex of O2-avid hemoglobin from the trematode Paramphistomum epiclitum pdf

... move away from the heme and the B-helix moves closer to the heme in the WT metHbthanintherWTmetHbH 2 O crystal structure, with the result that the ligated water is lost in the latter complex [16,17]. Prior ... position E7 as the source of the H- bond to ligand on the basis of a partial sequence, which had indicated a Tyr on the distal E-helix. The similari...

Ngày tải lên: 23/03/2014, 17:22

14 505 0
The Case for Controlled-Atmosphere Killing of Poultry in Transport Containers Prior to Shackling as a Humane Alternative to Electrical Stunning doc

The Case for Controlled-Atmosphere Killing of Poultry in Transport Containers Prior to Shackling as a Humane Alternative to Electrical Stunning doc

... company, American Autoflow, Inc., which serves North and South America, the “average price for an in- plant Easyload system fitted with gas stunning; washer; automatic drawer loading and unloading ... reducing the need for carcass and fillet examination. This is significant, considering that Raj (1998b) The Case for Controlled-Atmosphere Killing of Poultry in Tr...

Ngày tải lên: 31/03/2014, 08:20

16 504 0
Báo cáo Y học: Evidence for general stabilization of mRNAs in response to UV light pdf

Báo cáo Y học: Evidence for general stabilization of mRNAs in response to UV light pdf

... effect on stabilization by UV light (Fig. 2B). The data indicate that stabilization in response to UV light occurs independently of the p38 MAP kinase/ MK2 pathway. Fig. 1. UV light induces stabilization ... 2002 General mRNA stabilization by UV light (Eur. J. Biochem. 269) 5831 UV light but not activation of p38 MAP kinase increases cytoplasmic HuR-bi...

Ngày tải lên: 31/03/2014, 08:20

10 452 0
w