Báo cáo y học: "The SET -domain protein superfamily: protein lysine methyltransferase" docx
Báo cáo y học: "The SET -domain protein superfamily: protein lysine methyltransferase" docx
... 119 YAPI AIF KTKH-K GY G VRA E QDIEA NQ FIYEYKGE V IEEMEFRDRLIDYDQRHFKHF YFM MLQNGE F H4-K20 SET8 255 KEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYH G DL I EITDAKKREAL Y AQDPSTGCYMY Y FQYLS KTY C Specificity HKMT Residue H3-K4 SET7 /9 282 IDVPEPYNHVSKY CA SLGHK A NHSFTPNCI Y DMFV H PRF ... of a lysine residue on the histone or other protein, leaving a methylated lysine residue and the cofacto...
Ngày tải lên: 14/08/2014, 14:21
Báo cáo Y học: The Saccharomyces cerevisiae type 2A protein phosphatase Pph22p is biochemically different from mammalian PP2A potx
... of other polycations on phosphorylase phosphatase activity of yeast and mamma- lian PP2Ac poly- L -lysine was added to the purified enzymes. As presented in Fig. 5 a peak of poly- L -lysine- stimulated ... activity vs. 2.5-fold activation of PP2Ac). PR65/A subunit (3 n M ) increased activation of PP2Ac by poly- L -lysine by approximately 70% and it also increased stimulation of Pph22p by...
Ngày tải lên: 08/03/2014, 22:20
Báo cáo y học: "The tandem CCCH zinc finger protein tristetraprolin and its relevance to cytokine mRNA turnover and arthritis" pot
... phosphorylation. This occurred more slowly than the generally accepted model of protein phosphorylation, in which a previously synthesized protein is acted upon within a few minutes by a newly activated protein ... phosphorylated by one or more protein kinases that were either slowly activated by LPS or whose biosynthesis was also stimulated by LPS; fourth, the phosphorylation of the...
Ngày tải lên: 09/08/2014, 01:24
Báo cáo y học: "The WUS homeobox-containing (WOX) protein family" ppsx
... *Institute of Biology III, Faculty of Biology, University of Freiburg, Schänzlestrasse 1, D-79104 Freiburg, Germany. † Freiburg Initiative for Systems Biology (FRISYS), University of Freiburg, Schänzlestrasse ... of signaling by the plant hormone cytokinin. AAR-A proteins probably act by competing for phosphorylation with the ARR-B positive regulators of cytokinin signaling - phosphoryl...
Ngày tải lên: 09/08/2014, 20:21
Báo cáo y học: "The dimerization domain of HIV-1 viral infectivity factor Vif is required to block virion incorporation of APOBEC3G" ppsx
... saline. Cell viability was assessed by a trypan blue exclusion assay preformed as described by the vendor (Invitrogen). Infectivity Assays and Quantification Infectivity assays for Figure 1 were ... accessory proteins independently cause HIV-1-induced T cell cytopathicity and cell cycle arrest. Proc Natl Acad Sci U S A 2006, 103(9):3369-3374. 64. Yang X, Gabuzda D: Mitogen-activated protein...
Ngày tải lên: 13/08/2014, 05:22
Báo cáo y học: " The connection domain in reverse transcriptase facilitates the in vivo annealing of tRNALys3 to HIV-1 genomic RNA" potx
... tRNA Lys into HIV-1 consists of Gag, GagPol, tRNA Lys , lysyl-tRNA synthetase (LysRS), and viral genomic RNA. Gag targets tRNA Lys for viral packaging through Gag's interaction with LysRS, ... significantly effect tRNA Lys incorporation, but do severely reduce the ability of tRNA Lys3 to be functionally annealed to the viral RNA genome. Rescue of tRNA Lys3 annealing by GagPol As ......
Ngày tải lên: 13/08/2014, 13:20
Báo cáo y học: "The role of unintegrated DNA in HIV infection" docx
... immunodefi- ciency virus (FIV) that does not encode nef,butdoes contain rev [184]. Preintegration latency may contribute to viral RNA decay dynamics with therapy, but is likely to play only a minor ... from single-cell lysis induced by human immunodeficiency virus type 1. J Virol 1992, 66 :5777-5787. 39. Bukrinsky MI, Sharova N, Dempsey MP, Stanwick TL, Bukrinskaya AG, Haggerty S, Stevenson M...
Ngày tải lên: 13/08/2014, 01:21
Báo cáo y học: "The integrins are a superfamily of cell adhesion receptors that bind to extracellular matrix ligands, cell-surface ligands, and soluble ligands. They are transmembrane α" ppsx
... signaling Chemokines Integin Selectin ICAM Chemokine receptor (a) Leukocyte rolling Leukocyte arrest(b) Glycoprotein selectin ligand Genome Biology 2007, 8:215 Protein family review The integrins Yoshikazu Takada*, Xiaojing Ye* and Scott Simon † Addresses: ... glycoprotein selectin ligands (yellow and purple) on the leukocyte to selectins (blue) on the endothelial surface, and weak binding...
Ngày tải lên: 14/08/2014, 07:21
Báo cáo y học: "The membrane-spanning domain of gp41 plays a critical role in intracellular trafficking of the HIV envelope protein" pptx
... helices. Addition of lysine residues at both ends was necessary to allow us to purify the extremely hydrophobic MSD peptide. We cannot completely exclude the possibility that these lysine residues ... fusion activity, represented by renilla luciferase activity, was normalized by firefly luciferase activity to obtain trans- fection efficiency [18]. The polyclonal anti-halo antibody was obt...
Ngày tải lên: 13/08/2014, 01:20
Báo cáo y học: "The HTLV-1 Tax protein binding domain of cyclin-dependent kinase 4 (CDK4) includes the regulatory PSTAIRE helix" pptx
... tran- sition in human lymphocytes by the human T-cell leukemia/ lymphotropic virus type 1 Tax protein. J Virol 1998, 72:633-640. 7. Azran I, Schavinsky-Khrapunsky Y, Aboud M: Role of Tax protein in human ... p53 in human T-lymphocytes trans- formed by HTLV-I. Oncogene 1993, 8:3029-3036. 34. Ariumi Y, Kaida A, Lin JY, Hirota M, Masui O, Yamaoka S, Taya Y, Shi- motohno K: HTLV-1 tax oncop...
Ngày tải lên: 13/08/2014, 09:21