Báo cáo khoa học: " Multidisciplinary approach of early breast cancer: The biology applied to radiation oncology" pps

... 5 REVIEW Open Access Multidisciplinary approach of early breast cancer: The biology applied to radiation oncology Céline Bourgier 1* , Mahmut Ozsahin 2 , David Azria 3 Abstract Early breast cancer treatment ... 11:7426-33. doi:10.1186/1748-717X-5-2 Cite this article as: Bourgier et al.: Multidisciplinary approach of early breast cancer: The biology a...

Ngày tải lên: 09/08/2014, 10:20

... response to errors of omission, since these are the first to occur and thus lead to the system's first steps beyond the one-word stage. I consider the omission of content words first, and then ... will describe the agent or action of an event instead of the object. However, as AMBER begins to prefer agents to actions and actions to objects, the pro...

Ngày tải lên: 17/03/2014, 19:21

... transfec- tion of miR-27a or miR-27b failed to markedly decrease levels of PPARc protein at each time point of observation as compared to the respective miR con- trols. The effects of miR-27 on the expression ... conditions. Expression of miR-27 is elevated in obese mice In order to gain insights into the potential biologically relevant role of miR-27 in the regula...

Ngày tải lên: 18/02/2014, 08:20

... studies of deuteroporphyrin IX to the H-subunit show a K d value of 0.53–1.2 l M [5]. The large subunit has therefore been suggested to be the catalytic subunit. The exact role of the other two ... understand the reason and a possible function of the instability of the 70 kDa subunit. Obviously, the D subunit is a substrate of the I subunit, which led to...

Ngày tải lên: 19/02/2014, 12:20

... coordinated to the metal ion or bound to the protein in close proximity of the paramagnetic center the dipolar interaction is modu- lated by the reorientation of the macromolecule with respect to the applied ... Perrin JH (1980) The effect of albu- min conformation on the binding of warfarin to human serum albumin. The dependence of the binding of w...

Ngày tải lên: 20/02/2014, 02:22

... persons in Japanese history. From these fifty terms, the system collected 610 terms in total; the average number of output terms per input is 12.2 terms. We checked whether each of the 610 terms is ... that the system can be used as a tool that helps us compile a glossary. Second, we tried to examine the recall of the system. It is impossible to calculate the actual re-...

Ngày tải lên: 20/02/2014, 16:20

... used in chemotherapy of ton- gue cancer, but the effectiveness of monotherapy with PYM for preoperative chemotherapy is only about 67% [5,6]. Moreover, the therapeutic benefits of che- motherapy can ... medulloblastoma cells, perhaps because of the methylation of the promoter, and restoration of DKK1 expression can induce apoptosis and suppress colony formation [42]. As a s...

Ngày tải lên: 06/03/2014, 22:21

... plasma. Identification of prothrombin as a plasma factor participating in plactin activity To identify the plasma cofactor required for plactin promotion of scu-PA proteolysis to tcu-PA, we attempted to develop ... yielding 2.3 g of partially purified cofactor preparation (fraction E4A50). The specific activity of the preparation was 24 times that of the original plasma....

Ngày tải lên: 07/03/2014, 00:20

... addi- tion, the band at  1.0 GPa in Fig. 5C does not resemble the broad, featureless band typical of an unfolded protein. Taken together, these observations suggest that the unfolding at the level of the ... 113 of the large volume change associated with the forma- tion of a free charge [30]. Hence, a reduction in the number of electrostatic interactions would incre...

Ngày tải lên: 07/03/2014, 03:20

... verified the binding of pyrrho- coricin to the E. coli DnaK fragment and the lack of a sequence analogous to that of S. aureus (Fig. 6). To study the interaction of the antibacterial peptide and the ... FEHKRKELEQVCNPIISGLYQGAGGPGPGGFGA a The fluorescein-label was directly coupled to the amino-termini of the peptides. b The fluorescein-label was directly cou...

Ngày tải lên: 08/03/2014, 10:20