controllable synthesis of zno architectures by a surfactant-free hydrothermal process
... Controllable synthesis of ZnO architectures by a surfactant-free hydrothermal process Guixiang Du a, ⁎ , Lidong Zhang b , Yan Feng a , Yanyan Xu a , YuXiu Sun a , Bin Ding a , Qian Wang a a College ... diameter in each tube has been rarely reported in a surfactant-free hydrothermal pr ocess. When HMTA was employed, the hexagonal ZnO tubular bunches radi...
Ngày tải lên: 06/05/2014, 13:22
... www.elsevier.com/locate/apsusc Controllable hydrothermal synthesis of ZnO nanowires arrays on Al-doped ZnO seed layer and patterning of ZnO nanowires arrays via surface ... the ZnO- NWZ enlarge extremely with the increase of the hydrothermal tempera- ture as compared to that of the ZnO- NWA. A reasonable explanatio...
Ngày tải lên: 06/05/2014, 13:22
... Dang Li a , Xiangchao Zhang b , Jianlin Chen a , Shiying Zhang b a Department of Chemistry and Biological Engineering, Changsha University of Science and Technology, ... ZnO dandelions by a modified Kirkendall process. Jana et al. [18] prepared water lily-type ZnO flowers by a simple solution method, and Elia...
Ngày tải lên: 06/05/2014, 13:23
shape-controllable synthesis of ultrafine zno powders of different
... ultrafine crystalline of ZnO is a good example, which is an attractive material due to its wide variety of application including pigments, catalysts and phosphors [3,4] . There are lots of ways ... hydroxide with analytic grade were used as raw materials. Polyethylene glycol (PEG20000) with analytic grade was used as dispersant agent. Distilled water was obtained in laboratory. 2.2....
Ngày tải lên: 06/05/2014, 13:26
Treatment of Textile Wastewater by a Coupling of Activated Sludge Process with Membrane Separation
... quality, and kinetic parameters were also investigated. Fig. 1. Schematic Diagram of the Coupling of Activated Sludge Process and Membrane Separation MATERIALS AND METHODS Wastewater ... Experimental Setup. A schematic diagram of the activated sludge process employed in this study is shown in Figure 1. The main unit consisted of an aeration tank and a microfiltra...
Ngày tải lên: 05/09/2013, 09:08
Báo cáo khoa học: Heterologous synthesis of cytochrome c¢ by Escherichia coli is not dependent on the System I cytochrome c biogenesis machinery ppt
... mkriamitaltlcaaaahaDALKPEDKVKFRQAS mkhvlastaaglmalgl-assaiaAGLSPEEQIETRQAG mkklstlaalacmtvgsll-atsaqaQFAKPEDAVKYRQSA mrrvllatlmaalpaaaMAADAEHVVEARKGY (1) H. thermoluteolus (2) A. vinosum (3) A. ... FSLVALEFGPLAAM-AKGEMPYDAAAAKAHASDLVTLTKYDPSDLYAPGTSAD-DVKGTA LKENFFQEQDEVRKIATNFVEQANKLAEVAAMGDKDEIKAQFGEVGKACKACHEKFREEE VKPEFFQNMEDVGKIAREFVGAANTLAEVAATGEAEAVKTAFGDVGAACKSCHEKYRAK- ARPEIWSDA...
Ngày tải lên: 06/03/2014, 00:20
Báo cáo khoa học: Three-step hydroxylation of vitamin D3 by a genetically engineered CYP105A1 doc
... 7500 E-mail: tsakaki@pu-toyama.ac.jp Database Structural data are available in the Protein Data Bank database under the accession numbers 3CV8 and 3CV9 (Received 14 May 2010, revised 1 July 2010, accepted ... sites, was prepared using the primers 5¢-ACCAAGCTTATGAAAAGATACCGCCAC- GACG-3¢ and 5 ¢-TTCTGCAGTCACCAGGTGACCGG- GAGTTCG- 3¢, and the expression plasmid for R73V ⁄ R8 4A in E. coli cells...
Ngày tải lên: 15/03/2014, 23:20
synthesis and growth of hematite nanodiscs through a facile hydrothermal approach
... was prepared by depositing a few drops of a dilute solution of the nanoparticles onto a mica disc and then dried in air naturally. Analysis of the AFM image was performed using the WSxM software ... nanoparticles by BET tech- nique, as shown in Fig. 10b. The measured curves for calculating BET surface area of particles were plotted and analyzed. It can be seen that the surfa...
Ngày tải lên: 20/03/2014, 13:08
Báo cáo khoa học: Cytosol–mitochondria transfer of reducing equivalents by a lactate shuttle in heterotrophic Euglena docx
... in aerobic pathways. Proc. Natl Acad. Sci. USA 85, 1888–1892. 34. Takenaka, S., Kondo, T., Nazeri, S., Tamura, Y., Tokunaga, M., Tsuyama, S., Miyatake, K. & Nakano, Y. (1997) Accumulation of trehalose ... intracellular lactate shuttle. Proc. Natl Acad. Sci. USA 96, 1129–1134. 40. Valenti, D., de Bari, L., Atlante, A. & Pasarella, S. (2002) L -lactate transport into rat heart mitoch...
Ngày tải lên: 30/03/2014, 20:20
Báo cáo Y học: Characterization of heparin binding by a peptide from amyloid P component using capillary electrophoresis, surface plasmon resonance and isothermal titration calorimetry ppt
... to tetra- saccharide, hexasaccharide, octasaccharide, decasaccharide, dodecasaccharide and tetradecasaccharide, and DUA is 4-deoxy -a- L -threo-hexenopyranosyluronic acid), were pre- pared from ... sensorgram of regular (A) and scrambled (B) AP-1 peptide– heparin oligosaccharides interaction. The oligosaccharides shown are: (X2) tetrasaccharide (X3) hexasaccharide (X4) octasaccharide (X5)...
Ngày tải lên: 31/03/2014, 23:20