Báo cáo khoa học: A novel glycogen-targeting subunit of protein phosphatase 1 that is regulated by insulin and shows differential tissue distribution in humans and rodents pdf

... Novel glycogen-targeting subunit of PP1 A novel glycogen-targeting subunit of protein phosphatase 1 that is regulated by insulin and shows differential tissue distribution in humans and rodents Shonagh ... ATC CAC TTT ATC TGA gacgaggcgcctgcggccgacggcggaaaacaccaaaggcacccgggggcggggcgacccgatgtggcggggaggagtag 920 276 I H F I * 279 9 21 gagagac...

Ngày tải lên: 30/03/2014, 16:20

... (sense) and 5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primers for unmethylated DNA were: 5¢-GAAGTAGGTGGAGT ATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCT ACTT-3¢ (antisense). Caspase 3 activity Cells ... (Occ WT ) and variant occludin in apoptosis and invasion, as determined by assay, we revealed that exon 9 played a major role in the induc- tion of mitochondria-mediated apopto...

Ngày tải lên: 18/02/2014, 18:20

... preferentially expressed in brain. Biochim Biophys Acta 13 50, 11 14 . 11 Ogawa K, Yamada T, Tsujioka Y, Taguchi J, Takaha- shi M, Tsuboi Y, Fujino Y, Nakajima M, Yamamoto T, Akatsu H, Mitsui S & Yamaguchi ... hippostasin ⁄ KLK 11 is up -regulated in ovarian and prostate cancers [17 ]. Recent experimental data suggest that human kallikreins promote or inhibit tumor growth,...

Ngày tải lên: 16/03/2014, 23:20

... six-transmembrane domain structure of presenilin 1. J Biol Chem 272, 12 047 12 0 51. 24 Nakai T, Yamasaki A, Sakaguchi M, Kosaka K, Miha- ra K, Amaya Y & Miura S (19 99) Membrane topology of Alzheimer’s ... ER-retention, nicastrin-binding and gamma-secretase activity. Embo J 23, 4738–4748. 14 Tomita T, Takikawa R, Koyama A, Morohashi Y, Takasugi N, Saido TC, Maruyama K &...

Ngày tải lên: 23/03/2014, 13:20

... * Agtcgcccttctcagcgttccatcgatgcacacctgctatcgtggaacag cctagaaaccaagggactccaccaccaagtcacttcccctgctcgtgcag aggcacgggatgagtctgggtgacctctgcgccatgcgtgcgagacacgt gtgcgtttactgttatgtcggtcatatgtctgtacgtgtcgtgggccaac ctcgttctgcctccagctttcctggttagcgcaacgcggctccacgacca cacgcacttcagggtggaagctggaagctgagacacaggttaggtggcgc gaggctgccctgcgctccgctttgctttgggattaatttattctgcatct gctgagaggggcaccccagccatatcttacactttg...

Ngày tải lên: 30/03/2014, 14:20

... aggregation has been characterized for major nucleoproteins including histone H1 [14 ], topoisomerase II [15 ], lamin B1 [16 ] and SAF -A (hnRNP U) [17 ]. It is known that the aggregation of DNA is ... DNA (0 .1 lg) (Fig. 1C, lanes 7 and 14 ). After a 2.7 kbp linearized-plasmid DNA was coaggregated with human nuclear fractions, an EJ reaction was initiated by the addition...

Ngày tải lên: 19/02/2014, 06:20

... 2 011 ) doi :10 .11 11/ j .17 42-4658.2 011 .08240.x Bovine glutamate dehydrogenase is potently inhibited by zinc and the major impact is on V max suggesting a V-type effect on catalysis or product release. Zinc ... compilation ª 2 011 FEBS the glutamate binding domain. Both regions are part of the $ 18 ° movement of the NAD binding domain during catalysis [30, 31] . Therefore...

Ngày tải lên: 05/03/2014, 23:20

... 5A) . The Fdx ⁄ CYP17 5A1 ratio was saturated at 8 : 1, and the turnover rate at an Fdx ⁄ CYP17 5A1 ratio of 8 : 1 was 4.9-fold greater than that at a ratio of 1 : 1 (Fig. 5B). The addition of appropriate ... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 3 21 A. pernix 283 TSIPGIFAAGDCTSMWPG...

Ngày tải lên: 18/02/2014, 08:20

... evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide Atsuhiro Kanda, Kyoko Takuwa-Kuroda, Masato Aoyama and Honoo Satake Suntory Institute for Bioorganic Research, Osaka, Japan Tachykinins ... tachykinins: a review. Zool Sci 5, 533–549. 7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy- ama M, Minakata H, Chiba T, Metoki H, Satou Y & Satoh N (2004) Tachyki...

Ngày tải lên: 19/02/2014, 00:20

... the concentration of substrates gave a family of parallel lines (Fig. 1) , indicating that the reaction mechanism is a ping-pong mechanism. This result demonstrated that the GPX mimic, 6-CySeCD, has the ... mito- chondrial swelling and a decrease in mitochondria integrity. TBARS content in ferrous sulfate ⁄ ascorbate-treated mitochondria was analyzed by thiobarbituric...

Ngày tải lên: 19/02/2014, 02:20