Báo cáo khoa học: A novel mannitol teichoic acid with side p

Báo cáo khoa học: A novel mannitol teichoic acid with side phosphate groups ofBrevibacterium sp.VKM Ac-2118 ppt

... A novel mannitol teichoic acid with side phosphate groups of Brevibacterium sp. VKM Ac-2118 Natalia V. Potekhina 1 , Alexander S. Shashkov 2 , Lyudmila I. Evtushenko 3 , Ekaterina Yu. Gavrish 3 , Sofya ... a 1,6-poly (mannitol phosphate) chain with phosphate groups attached as side groups to O-4(3) of mannitol residues. In addition, small amounts of glyc...

Ngày tải lên : 23/03/2014, 15:21

6
222
0

Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt

... ascorbate-treated mitochondria was analyzed by thiobarbituric acid assay [34]. In this assay, thiobarbituric acid reacts with malonal- dehyde and ⁄ or other carbonyl by-products of free-radical- mediated ... CumOOH, and NADPH were also obtained from Sigma. Sephadex G-25 was purchased from Pharmacia (Uppsala, Sweden). All the other materials were of analytical grade and obtained from B...

Ngày tải lên : 19/02/2014, 02:20

9
491
0

Tài liệu Báo cáo khoa học: A novel nuclear DNA helicase with high speciﬁc activity from Pisum sativum catalytically translocates in the 3¢ﬁ5¢ direction docx

... cross-react with antibodies against plant helicases including PDH45 and PDH65 and also against human DNA helicases I, II, III and IV (data not shown). ssDNA-dependent ATPase activity was present at a ... used are given at the top of each lane of each gel. The quantitative data are displayed on the left side of each autoradiogram. In all gels, lane 1 (control) is the reaction without enz...

Ngày tải lên : 20/02/2014, 11:20

11
573
0

Báo cáo khoa học: A novel inhibitor of indole-3-glycerol phosphate synthase with activity against multidrug-resistant Mycobacterium tuberculosis pptx

... Asn189 fi Ala 20.34 18.00 Pro63 fi Ala 2.49 2.20 Ala190 fi Ala ND ND Ser64 fi Ala 1.53 1.40 Arg191 fi Ala 6.63 5.87 Glu168 fi Ala 21.67 19.17 Asn192 fi Ala 2.57 2.28 Val169 fi Ala 1.53 1.40 Leu193 fi Ala 1.42 ... Fudan University, Shanghai 200433, China Fax: +86 21 65648376 Tel: +86 21 65643777 E-mail: hhwang@fudan.edu.cn J. Yue, Department of Clinical Laboratory, Shanghai Pulmonary Hospital, Shanghai...

Ngày tải lên : 07/03/2014, 03:20

11
440
0

Báo cáo khoa học: A novel transmembrane topology of presenilin based on reconciling experimental and computational evidence pptx

... Chiesa R & Harris DA (1997) Evidence for a six-transmembrane domain structure of presenilin 1. J Biol Chem 272, 12047–12051. 24 Nakai T, Yamasaki A, Sakaguchi M, Kosaka K, Miha- ra K, Amaya ... Tomita T, Takikawa R, Koyama A, Morohashi Y, Takasugi N, Saido TC, Maruyama K & Iwatsubo T (1999) C terminus of presenilin is required for overproduction of amyloidogenic Abeta42 through st...

Ngày tải lên : 23/03/2014, 13:20

7
458
0

Báo cáo khoa học: A novel phosphorylated glycoprotein in the shell matrix of the oyster Crassostrea nippona pptx

... phosphorylated glycoprotein in the shell matrix of the oyster Crassostrea nippona Tetsuro Samata, Daisuke Ikeda, Aya Kajikawa, Hideyoshi Sato, Chihiro Nogawa, Daishi Yamada, Ryo Yamazaki and Takahiro Akiyama Laboratory ... (1996) A carbonic anhydrase from the nacreous layer in oyster pearls. Proc Natl Acad Sci USA 93, 9657–9660. 2 Sudo S, Fujikawa T, Nagakura T, Ohkubo T, Sakagu- chi K, Tan...

Ngày tải lên : 30/03/2014, 04:20

13
425
0

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... 277 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... DNA poly- merase was purchased from Toyobo (Osaka, Japan). Emul- gen 911 was a gift from Kao Chemical (Tokyo, Japan). NADPH, NADH and NADP + were purchased from Oriental Yeast (Tokyo...

Ngày tải lên : 18/02/2014, 08:20

14
617
0

Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx

... (sense) and 5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primers for unmethylated DNA were: 5¢-GAAGTAGGTGGAGT ATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCT ACTT-3¢ (antisense). Caspase 3 activity Cells ... caspase assay were seeded on a 24-well plate and transfected with FuGENE 6. The caspase assay was performed using the CaspACE colorimetric assay kit as described by the manufacturer (Promega)....

Ngày tải lên : 18/02/2014, 18:20

12
613
0

Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt

... vulgaris). Biochem J 387, 85–91. 25 Kanda A, Takahashi T, Satake H & Minakata H (2006) Molecular and functional characterization of a novel gonadotropin-releasing-hormone receptor isolated ... 8, 459–467. 10 Kanda A, Iwakoshi-Ukena E, Takuwa-Kuroda K & Minakata H (2003) Isolation and characterization of novel tachykinins from the posterior salivary gland of the common octopus...

Ngày tải lên : 19/02/2014, 00:20

11
595
0

Tài liệu Báo cáo khoa học: A novel type of highly negatively charged lipooligosaccharide from Pseudomonas stutzeri OX1 possessing two 4,6-O-(1-carboxy)-ethylidene residues in the outer core region ppt

... characteristic monosaccharide residues, a large number of phosphate groups at the proper location, a carbamoyl moiety, and an acetyl group. It is worth noting that the nature and the localization ... 2701 alkaline and acid degradation allowed the complete iden- tiﬁcation and localization of the labile groups, i.e. pyro- phosphate groups, which are commonly lost in alkaline treat...

Ngày tải lên : 19/02/2014, 13:20

14
715
0

Báo cáo khoa học: A novel mannitol teichoic acid with side phosphate groups ofBrevibacterium sp VKM Ac-2118 ppt

Báo cáo khoa học: A novel mannitol teichoic acid with side phosphate groups ofBrevibacterium sp.VKM Ac-2118 ppt

Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt