Báo cáo Y học: Autophosphorylation-dependent inactivation of plant chimeric calcium/calmodulin-dependent protein kinase docx
Tài liệu Báo cáo Y học: Functional analysis of DM64, an antimyotoxic protein with immunoglobulin-like structure from Didelphis marsupialis serum pdf
... capacity of DM64 to inhibit the myotoxicity induced by myotoxins I (Asp49) and II (Lys49) from B. asper venom was analyzed in vivo and in vitro. DM64 effectively neut- ralized the myotoxic and cytotoxic ... three domains and are present in the inhibitory receptors of Fig. 6. Inhibition of in vitro cytotoxicity of myotoxins I or II by DM64. Cytotoxicity was analyzed in vitro using C2C1...
Ngày tải lên: 21/02/2014, 01:21
Tài liệu Báo cáo Y học: Kinetic properties of bifunctional 6-phosphofructo-2-kinase/ fructose-2,6-bisphosphatase from spinach leaves pdf
... of isoforms of the bifunctional enzyme from plants [11,12,14], suggesting that such proteolysis may be a widespread problem. The sensitivity of the plant bifunctional enzyme to degradation by ... 6-P 2 ase activity. The smaller L -form of the enzyme (native M r 132 000) consisted of a variable group of catalytically active polypeptides with M r of 44 000– 70 000. Despite the p...
Ngày tải lên: 22/02/2014, 04:20
Báo cáo Y học: Does phosphorylation of the cap-binding protein eIF4E play a role in translation initiation? ppt
... to studying the role of the phosphorylation of eIF4E is to study the effects of expression of eIF4E kinases, or of eIF4E variants with mutations at the phosphorylation site, on protein synthesis ... the p38 MAP kinase pathway, they do not cause increased phosphorylation of eIF4E [32]. This probably reflects the fact that they cause loss of eIF4F complexes (due to dephosphoryl...
Ngày tải lên: 23/03/2014, 21:20
Báo cáo Y học: Histidine mutagenesis of Arabidopsis thaliana pyruvate dehydrogenase kinase ppt
... LAGYGYGLPLSRLYAR IK+SD GGG+ R+ L RIFTY+YSTA P +AGYGYGLPISRLYAR G1-box G2-box YFGGDLQIISMEGYGTDAYLHL-SRLGDSQEPLP YFGGDLQIISMEGYGTDAYLHL-SRLGDSEEPLP YFQGDLQLFSMEGFGTDAVIYLKALSTDSVERLPVYNKSAWRHHYQTIQEAGDWCVPSTE ... IKVSDEGGGIARSGLPRIFTYLYSTARNPLEEDVDLGIADVPVTMAGYGYGLPISRLYAR IKISDEGGGIPRSGLSRIFTYLYSTAENPPD LDGHNEG-VTMAGYGYGIPISRLYAR IKMSDRGGGVPLRRIERLFSYMYSTAPTPQPGTGG TPLAGFGYGLPISRLYAK...
Ngày tải lên: 31/03/2014, 15:20
Báo cáo khoa học: Covalent activation of heart AMP-activated protein kinase in response to physiological concentrations of long-chain fatty acids docx
... phosphorylation of Thr172 within the a-subunit of AMPK, catalysed by an upstream AMPK kinase. Dephosphorylation of Thr172 (in vivo by phospho- protein phosphatase 2C [5]) leads to inactivation of ... palmitoyltransferase-1 (CPT1). Malonyl-CoA is synthesized and disposed of by acetyl-CoA carboxylase (ACC) and malonyl-CoA decarboxylase (MCD), respectively. ACC is inactivated thro...
Ngày tải lên: 07/03/2014, 15:20
Báo cáo Y học: Atlantic salmon possess three mitogen activated protein kinase kinase 6 paralogs responding differently to stress pot
... Norway 4 Department of Pharmacology, Institute of Medical Biology, University of Tromsø, Norway The p38 group of mitogen-activated protein kinases (MAPKs) is activated by pro-inflammatory cytokines and ... Biotechnology, Norwegian College of Fishery Science, University of Tromsø, Norway 2 The Norwegian Structural Biology Centre (NorStruct), University of Tromsø, Norway 3 Comput...
Ngày tải lên: 24/03/2014, 00:21
Báo cáo khoa học: Acute activation of Erk1/Erk2 and protein kinase B/akt proceed by independent pathways in multiple cell types ppt
... phosphati- dylinositol 3 -kinase in the activation of glycogen synthase and mitogen-activated protein kinase by insulin in rat adipocytes: comparison of insulin and protein kinase C modulators. Biochem Biophys Res ... types, the same type of stimulation may trig- ger different sets of signaling cascades. Thus, analysis of the same signaling pathways operating in different c...
Ngày tải lên: 30/03/2014, 20:20
Tài liệu Báo cáo Y học: Structural determinants of the half-life and cleavage site preference in the autolytic inactivation of chymotrypsin pdf
... sites of chymotrypsin. D-Chymotrypsinogen is a chimera constructed to contain a trypsinogen propeptide instead of the Cys1–Cys122-linked wild-type chymotryp- sinogen peptide. D-Chymotrypsinogen ... displayed by wild-type chymo- trypsin inactivation. The comparison of autolysis and autolytic inactivation data showed that: (a) the preferential cleavage of sites followed the order of...
Ngày tải lên: 22/02/2014, 07:20
Báo cáo Y học: Co-existence of two regulatory NADP-glyceraldehyde 3-P dehydrogenase complexes in higher plant chloroplasts ppt
... Sauermann 1 1 Plant Physiology, University of Osnabrueck, Germany; 2 Planton GmbH, Kiel, Germany; 3 Plant Physiology, University of Kaiserslautern, Kaiserslautern, Germany Light/dark modulation of the ... redox- modification at specific cysteine residues mediated by the ferredoxin/thioredoxin system [1]. The activity of each of these enzymes is adjusted by fine-tuning, the rates o...
Ngày tải lên: 08/03/2014, 09:20
Báo cáo y học: "The epidemiology of medical emergency contacts outside hospitals in Norway - a prospective population based study"
... with the complete set of AMIS forms, this yields a comprehen- sive material for analysis of the objectives of the study. There are some limitations of the study. Severity score (NACA) on patients ... deal with “everyday” emergency problems is needed in Norway. The large variety of symptoms and conditions may for instance indicate a need for more diagnostic competence at the scene o...
Ngày tải lên: 25/10/2012, 09:56