Báo cáo khoa học: Sub-zero temperature inactivation of carboxypeptidase Y under high hydrostatic pressure pot

... event at the temperature below )10 °C. Reversibility of low temperature inactivation of CPY under high pressure Time-dependent recovery of CPY activity was observed after the release of pressure ... Cold inactivation of CPY under high pressure (Eur. J. Biochem. 269) 4669 Effect of glycerol and sucrose upon cold inactivation of CPY under high pressure...

Ngày tải lên: 08/03/2014, 10:20

... motif, possibly within the catalytic domain, as well as propa- gation of the ANF ⁄ ATP binding signal and activation of the catalytic domain. This hypothesis was previously experimentally validated in tryptophan ... of guanylyl cyclases. Rev Physiol Biochem Pharmacol 135, 1–39. 7 Dizhoor AM & Hurley JB (1999) Regulation of photoreceptor membrane guanylyl cyclases by guanylyl cycla...

Ngày tải lên: 06/03/2014, 11:20

... (partially) shared by some of the other seven re- searchers. Comparison with Other Hypotheses Another way of evaluating the output of B and J is to compare them with the hypotheses of other researchers. ... test text, L test , they produce two hy- potheses, ˆ L test.B and ˆ L test.J . Ideally, they should be similar to the hypotheses offered by the same re- searchers (namely, L test.B...

Ngày tải lên: 08/03/2014, 02:21

... in- formation may be explicitly annotated in a treebank, it is rarely used or delivered by parsers. 1 The rea- son is that bringing in more information of this type usually makes the underlying parsing ... its POS; the head of ( ), its POS and the label of the dependency ; the closest left and right siblings of (depen- dents of ) and their POS tags; the label of the dependency ( )...

Ngày tải lên: 08/03/2014, 04:22

... value of adiabatic temperature rise and reaction velocity by classification of binder quantity 3.2 Temperature rise quantity and analysis of Mock-up Test The time reaching the highest temperature ... section 12 days THK 4,000㎜, 5,000㎜, 5,700㎜ section 1 layer of vinyl + 3 layers of curing blanket + roof 20 days (a) Temperature analysis of the total cross...

Ngày tải lên: 07/03/2014, 03:20

... reasons, not just because of the presence of pulmo- nary congestion. Similarly, physiotherapy and use of (higher) levels of positive end-expiratory pressure are applied routinely in our ICU, and are ... College of Radiology: Routine daily portable X-ray. [http://www.acr.org/ ]. 3. Bekemeyer WB, Crapo RO, Calhoon S, Cannon CY, Clayton PD: Efficacy of chest radiography in a respir...

Ngày tải lên: 25/10/2012, 10:39

... onset of schizogony and is processed by PfSUB1 at the time of merozoite egress from the infected erythrocyte. It has been previously shown that incubation of synchronic cultures with a highly specific inhibitor ... proteolytic hydrolysis of haemoglobin as a source of amino acids constitutes one of the essential processes which take place along the intra-erythrocytic stage of the...

Ngày tải lên: 14/02/2014, 14:20

... aa III MSTLFII S ILLFLAS F SYAMDI S TIEYKYDKSS AWRTDEEVKEIYELWLAKHDKVY SG LVEYEKRFEIFKDNLKFIDEH NSENHTYKMGLTPYTDLTNEEFQAIYLGTRSDTIHRLKRTINISERYAYEAGDNLPEQIDWRKKGAVTPVKNQGKCG SCWAFSTVSTVESINQIRTGNLISLSEQQLVDCNKKNHG CKGGAFVYAYQYIIDNGGIDTEANYPYKAVQGPCRAAK KVVRIDGYKGVPHCNENALKKAVASQPSVVAIDASSKQF QHYKSGIFSGPCGTKLNHGVVIVGYWKDYWIVRNSW GRYWGEQGYIRMKRVGGCGLCGIARLPYYPTKA AGDENSKLETPELLQWSEEAFPLA IV A B...

Ngày tải lên: 14/02/2014, 14:20

... to produce DNA glycosy- lases capable of excising both 5-hydroxymethylcytosine [214] and 5-methylcytosine [215]. The best candidates for such glycosylases are the thymine glycosylases TDG and MBD4 ... may also help explain why they are typi- cally maintained predominantly in either the highly methylated or the highly demethylated state. This is because any repressive modification is likely ....

Ngày tải lên: 14/02/2014, 18:20

... Florence, Italy 2 Department of Chemistry, University of Florence, Italy Introduction The first member of the family of Sco (synthesis of cytochrome c oxidase) proteins was identified in yeast as a ... all types of organisms, including the vast major- ity of eukaryotes and many prokaryotes. It is well established that Sco pro- teins in eukaryotes are involved in the assembly of...

Ngày tải lên: 14/02/2014, 18:20