Báo cáo khoa học: Glycoprotein Ib-mediated platelet activation A signalling pathway triggered by thrombin doc

... GPIb-coupled signalling pathway triggered by thrombin. Keywords: glycoprotein Ib; platelets; signalling; thrombin. Platelet activation by a- thrombin is an important event in normal haemostasis as well as ... 2003 Glycoprotein Ib-mediated platelet activation A signalling pathway triggered by thrombin Fre ´ de ´ ric Adam 1 , Marie-Claude Guillin 1,2 a...

Ngày tải lên: 08/03/2014, 02:21

... (h) AEEAFDLWNECAKACVLDLKDGVRSSRMSVDPAIADTNGQGVLHYSMVLEGGNDALKLAIDN ALSITSDGLTIRLEGGVEPNKPVRYSYTRQARGSWSLNWLVPIGHEKPSNIKVFIHELNAGN QLSHMSPIYTIEMGDELLAKLARDATFFVRAHESNEMQPTLAISHAGVSVVMAQTQPRREKR WSEWASGKVLCLLDPLDGVYNYLAQQRCNLDDTWEGKIYRVLAGNPAKHDLDIKPTVISHRL HFPEGGSLAALTAHQACHLPLETFTRHRQPR 279 1 ETA-B 280 GWEQLEQCGYPVQRLVALYLAARLSWNQVDQ V IRNALASPGSGGDLGEAIREQPEQARLALTLAAAESERFVRQGTGNDEAGAANADVV...

Ngày tải lên: 18/02/2014, 04:20

... of thermal inactivation and aggregation of lysozyme by polyamines Motonori Kudou 1 , Kentaro Shiraki 1 , Shinsuke Fujiwara 2 , Tadayuki Imanaka 3 and Masahiro Takagi 1 1 School of Materials Science, ... measuring the absorbance (A) at 600 nm. The rate constant of inactivation was determined by fitting the data to a linear extrapolation. CD spectra Far-ultraviolet CD spectra were measured...

Ngày tải lên: 20/02/2014, 02:21

... this paper will be described in more detail. 2.1 Aggregate Analysis of Bulgarian Dialectometry produces aggregate analyses of the dialect variations and has been done for different languages. ... quantitative analysis of Bulgarian dialect pro- nunciation reported in Osenova et al. (2007). In work done by Osenova et al. (2007) aggregate analysis of pronunciation differences for Bulgarian was...

Ngày tải lên: 20/02/2014, 12:20

... assign- ments are generated. If the same-synset assump- tion is valid and if the senses assigned in the database are accurate, then the human tagging has a recall of no more than 73%. Because awordsensewasassigned ... MajSimpleSgl and MajSimplePair in a majority vote with MajAggr (in MajSgl+Aggr 8 A pair cast a vote for asense if, amongall the senses of a verb, aspecificsensehadthe h...

Ngày tải lên: 20/02/2014, 18:20

... staff should be available on a 24-hour basis to assess and treat acutely ill hospital patients. Utilization of a MET system has been associated with a reduc- tion in all-cause hospital mortality ... paging system, and a detailed log of all calls is maintained. Criteria for medical emergency team activation Calling criteria for our MET service are based on acute changes in heart rate...

Ngày tải lên: 25/10/2012, 10:45

... min) induces activation of ERK1,2, which can be inhibited by active, but not by heat-inactivated (hia), catalase (1 mgÆmL )1 each), as shown by immunoblotting. Catalase and hia-catalase, respectively, ... regu- lates translocation and activation of Rac. J Biol Chem 278, 39413–39421. 69 Reid T, Furuyashiki T, Ishizaki T, Watanabe G, Watanabe N, Fujisawa K, Morii N, Madaule P & Na...

Ngày tải lên: 19/02/2014, 05:20

... sphingomyelinase pathways of acidic extracel- lular pH induced matrix metalloproteinase-9 expression, at least in part, through nuclear factor-jB activation. aSMase and Ca 2+ influx in acid induction ... Yokosuka, Japan 2 Department of Biology and Function in the Head and Neck, Yokohama City University Graduate School of Medicine, Japan 3 Department of Oral and Maxillofacial Surgery, Kanagaw...

Ngày tải lên: 07/03/2014, 09:20

... Gilles, A. M., Glaser, P., Krin, E., Danchin, A. , Sarfati, R. & Barzu, O. (1991) Isolation and characterization of catalytic and calmodulin-binding domains of Bordetella pertussis adenylate cyclase. ... France. Fax/Tel.:+33164468082, E-mail: jacques.gallay@lure.u-psud.fr Abbreviations: AC, adenylate cyclase catalytic domain; CaM, cal- modulin; AC-Y75C, AC mutant in which Tyr75 is repla...

Ngày tải lên: 07/03/2014, 15:20

... Abe, A. & Shayman, J .A. (1998) Purification and characterization of 1-O-Acylceramide synthase, a novel phospholipase A 2 with transacylase activity. J. Biol. Chem. 273, 8467–8474. 17. Catala ´ n, ... CoA-independ- ent transacylase from 1-radyl-2-arachidonoylGroPCho, generating lyso -platelet- activating factor derivatives, which can lead to formation of platelet- activating factor...

Ngày tải lên: 08/03/2014, 08:20