Báo cáo khoa học: Glycoprotein Ib-mediated platelet activation A signalling pathway triggered by thrombin doc

Báo cáo khoa học: Glycoprotein Ib-mediated platelet activation A signalling pathway triggered by thrombin doc

Báo cáo khoa học: Glycoprotein Ib-mediated platelet activation A signalling pathway triggered by thrombin doc

... GPIb-coupled signalling pathway triggered by thrombin. Keywords: glycoprotein Ib; platelets; signalling; thrombin. Platelet activation by a- thrombin is an important event in normal haemostasis as well as ... 2003 Glycoprotein Ib-mediated platelet activation A signalling pathway triggered by thrombin Fre ´ de ´ ric Adam 1 , Marie-Claude Guillin 1,2 a...

Ngày tải lên: 08/03/2014, 02:21

12 257 0
Tài liệu Báo cáo khoa học: Proteolysis of Pseudomonas exotoxin A within hepatic endosomes by cathepsins B and D produces fragments displaying in vitro ADP-ribosylating and apoptotic effects doc

Tài liệu Báo cáo khoa học: Proteolysis of Pseudomonas exotoxin A within hepatic endosomes by cathepsins B and D produces fragments displaying in vitro ADP-ribosylating and apoptotic effects doc

... (h) AEEAFDLWNECAKACVLDLKDGVRSSRMSVDPAIADTNGQGVLHYSMVLEGGNDALKLAIDN ALSITSDGLTIRLEGGVEPNKPVRYSYTRQARGSWSLNWLVPIGHEKPSNIKVFIHELNAGN QLSHMSPIYTIEMGDELLAKLARDATFFVRAHESNEMQPTLAISHAGVSVVMAQTQPRREKR WSEWASGKVLCLLDPLDGVYNYLAQQRCNLDDTWEGKIYRVLAGNPAKHDLDIKPTVISHRL HFPEGGSLAALTAHQACHLPLETFTRHRQPR 279 1 ETA-B 280 GWEQLEQCGYPVQRLVALYLAARLSWNQVDQ V IRNALASPGSGGDLGEAIREQPEQARLALTLAAAESERFVRQGTGNDEAGAANADVV...

Ngày tải lên: 18/02/2014, 04:20

15 588 0
Tài liệu Báo cáo khoa học: Prevention of thermal inactivation and aggregation of lysozyme by polyamines docx

Tài liệu Báo cáo khoa học: Prevention of thermal inactivation and aggregation of lysozyme by polyamines docx

... of thermal inactivation and aggregation of lysozyme by polyamines Motonori Kudou 1 , Kentaro Shiraki 1 , Shinsuke Fujiwara 2 , Tadayuki Imanaka 3 and Masahiro Takagi 1 1 School of Materials Science, ... measuring the absorbance (A) at 600 nm. The rate constant of inactivation was determined by fitting the data to a linear extrapolation. CD spectra Far-ultraviolet CD spectra were measured...

Ngày tải lên: 20/02/2014, 02:21

8 558 0
Tài liệu Báo cáo khoa học: "Identifying Linguistic Structure in a Quantitative Analysis of Dialect Pronunciation" docx

Tài liệu Báo cáo khoa học: "Identifying Linguistic Structure in a Quantitative Analysis of Dialect Pronunciation" docx

... this paper will be described in more detail. 2.1 Aggregate Analysis of Bulgarian Dialectometry produces aggregate analyses of the dialect variations and has been done for different languages. ... quantitative analysis of Bulgarian dialect pro- nunciation reported in Osenova et al. (2007). In work done by Osenova et al. (2007) aggregate analysis of pronunciation differences for Bulgarian was...

Ngày tải lên: 20/02/2014, 12:20

6 651 0
Tài liệu Báo cáo khoa học: "Mapping Lexical Entries in a Verbs Database to WordNet Senses" doc

Tài liệu Báo cáo khoa học: "Mapping Lexical Entries in a Verbs Database to WordNet Senses" doc

... assign- ments are generated. If the same-synset assump- tion is valid and if the senses assigned in the database are accurate, then the human tagging has a recall of no more than 73%. Because awordsensewasassigned ... MajSimpleSgl and MajSimplePair in a majority vote with MajAggr (in MajSgl+Aggr 8 A pair cast a vote for asense if, amongall the senses of a verb, aspecificsensehadthe h...

Ngày tải lên: 20/02/2014, 18:20

8 415 0
Báo cáo khoa học: "Circadian pattern of activation of the medical emergency team in a teaching hospita"

Báo cáo khoa học: "Circadian pattern of activation of the medical emergency team in a teaching hospita"

... staff should be available on a 24-hour basis to assess and treat acutely ill hospital patients. Utilization of a MET system has been associated with a reduc- tion in all-cause hospital mortality ... paging system, and a detailed log of all calls is maintained. Criteria for medical emergency team activation Calling criteria for our MET service are based on acute changes in heart rate...

Ngày tải lên: 25/10/2012, 10:45

4 541 0
Tài liệu Báo cáo khoa học: Rac upregulates tissue inhibitor of metalloproteinase-1 expression by redox-dependent activation of extracellular signal-regulated kinase signaling pptx

Tài liệu Báo cáo khoa học: Rac upregulates tissue inhibitor of metalloproteinase-1 expression by redox-dependent activation of extracellular signal-regulated kinase signaling pptx

... min) induces activation of ERK1,2, which can be inhibited by active, but not by heat-inactivated (hia), catalase (1 mgÆmL )1 each), as shown by immunoblotting. Catalase and hia-catalase, respectively, ... regu- lates translocation and activation of Rac. J Biol Chem 278, 39413–39421. 69 Reid T, Furuyashiki T, Ishizaki T, Watanabe G, Watanabe N, Fujisawa K, Morii N, Madaule P & Na...

Ngày tải lên: 19/02/2014, 05:20

16 485 0
Báo cáo khoa học: Acidic extracellular pH increases calcium influx-triggered phospholipase D activity along with acidic sphingomyelinase activation to induce matrix metalloproteinase-9 expression in mouse metastatic melanoma pot

Báo cáo khoa học: Acidic extracellular pH increases calcium influx-triggered phospholipase D activity along with acidic sphingomyelinase activation to induce matrix metalloproteinase-9 expression in mouse metastatic melanoma pot

... sphingomyelinase pathways of acidic extracel- lular pH induced matrix metalloproteinase-9 expression, at least in part, through nuclear factor-jB activation. aSMase and Ca 2+ influx in acid induction ... Yokosuka, Japan 2 Department of Biology and Function in the Head and Neck, Yokohama City University Graduate School of Medicine, Japan 3 Department of Oral and Maxillofacial Surgery, Kanagaw...

Ngày tải lên: 07/03/2014, 09:20

13 409 0
Báo cáo khóa học: Insight into the activation mechanism of Bordetella pertussis adenylate cyclase by calmodulin using fluorescence spectroscopy pptx

Báo cáo khóa học: Insight into the activation mechanism of Bordetella pertussis adenylate cyclase by calmodulin using fluorescence spectroscopy pptx

... Gilles, A. M., Glaser, P., Krin, E., Danchin, A. , Sarfati, R. & Barzu, O. (1991) Isolation and characterization of catalytic and calmodulin-binding domains of Bordetella pertussis adenylate cyclase. ... France. Fax/Tel.:+33164468082, E-mail: jacques.gallay@lure.u-psud.fr Abbreviations: AC, adenylate cyclase catalytic domain; CaM, cal- modulin; AC-Y75C, AC mutant in which Tyr75 is repla...

Ngày tải lên: 07/03/2014, 15:20

13 409 0
Báo cáo khoa học: Signaling events mediating activation of brain ethanolamine plasmalogen hydrolysis by ceramide pot

Báo cáo khoa học: Signaling events mediating activation of brain ethanolamine plasmalogen hydrolysis by ceramide pot

... Abe, A. & Shayman, J .A. (1998) Purification and characterization of 1-O-Acylceramide synthase, a novel phospholipase A 2 with transacylase activity. J. Biol. Chem. 273, 8467–8474. 17. Catala ´ n, ... CoA-independ- ent transacylase from 1-radyl-2-arachidonoylGroPCho, generating lyso -platelet- activating factor derivatives, which can lead to formation of platelet- activating factor...

Ngày tải lên: 08/03/2014, 08:20

11 235 0
Từ khóa:
w