Báo cáo khoa học: A novel metallobridged bis(b-cyclodextrin)s fluorescent probe for the determination of glutathione doc
Báo cáo khoa học: A novel metallobridged bis(b-cyclodextrin)s fluorescent probe for the determination of glutathione doc
... centrifugation. The final plasmasamples used in the determination of GSH wereobtained. Determination of GSH in plasma and accuracyassessment by recovery experimentsIn order to evaluate the applicability ... (II) may lead to a significant fluorescence recovery of the bis(b-CD)s. Therefore, a rapid and simple spectrofluorimetric method wasdeveloped for the determination of glutathione. The analytical application for ... solution wasmeasured at 365 ⁄ 480 nm. The GSH content of the plasma was derived from the standard curve and the regression equation. The average recovery test was made using the standardaddition...
- 8
- 429
- 0
Báo cáo khoa học: A novel serine protease highly expressed in the pancreas is expressed in various kinds of cancer cells potx
... from the humantrypsinogen prepro sequence was amplified from humanpancreatic cDNA using the primer set (forward, CCCAAGCTTACCATGAATCTACTCCTGAT; reverse, GTTGGTACCTTGTCATCATCATCAAAGG), and inserted ... 7(TACACACCCTGACCCGCATC) and 6 as template.Sequence analysis The sequence of the cDNA was analyzed using genetyxsoftware (Software Development Co. Ltd, Tokyo, Japan). A novel serine protease ... cycles of 95 °C for 30 s, 56 °C for 30 s, and 72 °C for 30 s, using the forward primer 5¢-GTGAGCATCCAGAAGAATGG-3¢,and the reverse primer 5¢-AAGTAGCCGGCACACAGCAT-3¢. PCR products were analyzed...
- 13
- 483
- 0
Báo cáo khoa học: "A Novel Discourse Parser Based on Support Vector Machine Classification" docx
... recent advances in the field of statistical machine learning (mul-tivariate capabilities of Support VectorMachines) and a rich feature space. RSToffers a formal framework for hierarchicaltext ... through manual annotation (our goldstandard). Standard performance indicators for such a task are precision, recall and F-score asmeasured by the PARSEVAL metrics (Black et al.,1991), with the ... way to many novel applications in real-time natural languageprocessing and generation, such as the RST-basedtransformation of monological text into dialoguesacted by virtual agents in real-time...
- 9
- 390
- 0
Báo cáo khoa học: "A Hierarchical Pitman-Yor Process HMM for Unsupervised Part of Speech Induction" doc
... 47th Annual Meet-ing of the Association for Computational Linguisticsand the 4th International Joint Conference on Natu-ral Language Processing of the Asian Federation of Natural Language Processing ... factthat these events are not independent; the counts of one trigram can affect the probability of later ones,and moreover, the table assignment for the trigrammay also affect the bigram and ... distribution (a x∼ Beta(1, 1)), and for the concentration parameters we use a vaguegamma prior (bx∼ Gamma(10, 0.1)). All the hyper-parameters are resampled after every 5thsample of the corpus.The...
- 10
- 422
- 0
Báo cáo khoa học: "A Ranking Approach to Stress Prediction for Letter-to-Phoneme Conversion" doc
... Shane Bergsma, Sittichai Jiampojamarn and Grzegorz KondrakDepartment of Computing ScienceUniversity of AlbertaEdmonton, AB, T6G 2E8, Canada{qdou,bergsma,sj,kondrak}@cs.ualberta.caAbstractCorrect ... Proceedings of the 47th Annual Meeting of the ACL and the 4th IJCNLP of the AFNLP, pages 118–126,Suntec, Singapore, 2-7 August 2009.c2009 ACL and AFNLP A Ranking Approach to Stress Prediction for ... stress ranker.AcknowledgementsThis research was supported by the NaturalSciences and Engineering Research Council of Canada, the Alberta Ingenuity Fund, and the Al-berta Informatics Circle of...
- 9
- 327
- 0
Báo cáo khoa học: A Kazal prolyl endopeptidase inhibitor isolated from the skin of Phyllomedusa sauvagii pdf
... interaction with theirmembranes.Materials and methodsMaterialsAll chemicals were of the purest analytical grade available.Proteases, aprotinin, lysozyme, and a- casein were fromSigma-Aldrich. ... protease inhibitor type of Kazalproteins. In particular, PSKP-1 is 48% identical to the inhibitor of acrosin – the major protease of mammalianspermatozoa – from the crab-eating monkey, Macacafascicularis ... pET-PSKP-1 as the templateand primers 5¢-CTGCCAGGCTGCCCGAAAGATATTAACCCGGTGTGC-3¢ and 5¢-CGGGCAGCCTGGCAGTTCATATTTATAGCATTTCGG-3¢ (the mutated codonsare underlined). The PCR product was cloned...
- 10
- 456
- 0
Báo cáo khoa học: "A Tradeoff between Compositionality and Complexity in the Semantics of Dimensional Adjectives" potx
... in all but the trivial case of measurements, whereas the non- compositional approach guarantees at least assimi- lation completeness for a subset of the parameters in the system. This means ... that the compositional ap- proach is contraindicated for all conceivable systems. In addition to the general theoretical appeal of com- positional semantics, the compositional formation of ... clear whether this approach can capture the duality of 350 For the computational analysis, we will need to classify the relations shown in Tables 1 and 2, since these relations form the...
- 10
- 537
- 0
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc
... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... of the FNR (Fig. 5A) . The Fdx ⁄ CYP17 5A1 ratio was saturated at 8 : 1, and the turnover rate at an Fdx ⁄ CYP17 5A1 ratio of 8 : 1 was4.9-fold greater than that at a ratio of 1 : 1 (Fig. 5B). The ... The zeaxanthin produced by CYP17 5A1 is used as an inter-mediate for the synthesis of thermozeaxanthins andthermobiszeaxanthins, which are the main carotenoids of T. thermophilus [15]. The insertion...
- 14
- 617
- 0
Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx
... 5¢-AAGTAGGCGGAGTATCGAAC-3¢ (sense) and5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primers for unmethylated DNA were: 5¢-GAAGTAGGTGGAGTATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCTACTT-3¢ (antisense).Caspase 3 activityCells ... intensity was determined using imagemaster2d elite software 4.01 (Amersham Bioscience, Uppsala,Sweden).Statistical analysisData in bar graphs are expressed as the mean and standarddeviation of three ... subjected to the caspase assay were seeded on a 24-well plate and transfected with FuGENE 6. The caspaseassay was performed using the CaspACE colorimetric assaykit as described by the manufacturer...
- 12
- 613
- 0
Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt
... 8,459–467.10 Kanda A, Iwakoshi-Ukena E, Takuwa-Kuroda K &Minakata H (2003) Isolation and characterization of novel tachykinins from the posterior salivary gland of the common octopus Octopus vulgaris. ... into tachykinin-related peptides, their receptors,and invertebrate tachykinins: a review. Zool Sci 5,533–549.7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy-ama M, Minakata H, Chiba T, Metoki ... in the common octopus (Octopus vulgaris).Biochem J 387, 85–91.25 Kanda A, Takahashi T, Satake H & Minakata H (2006)Molecular and functional characterization of a novel gonadotropin-releasing-hormone...
- 11
- 595
- 0
Từ khóa: báo cáo khoa họcbáo cáo khoa học mẫubáo cáo khoa học y họcbáo cáo khoa học sinh họcbáo cáo khoa học nông nghiệpbáo cáo khoa học lâm nghiệpNghiên cứu sự biến đổi một số cytokin ở bệnh nhân xơ cứng bì hệ thốngMột số giải pháp nâng cao chất lượng streaming thích ứng video trên nền giao thức HTTPGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANPhát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninhPhát hiện xâm nhập dựa trên thuật toán k meansNghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúngNghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000Thơ nôm tứ tuyệt trào phúng hồ xuân hươngSở hữu ruộng đất và kinh tế nông nghiệp châu ôn (lạng sơn) nửa đầu thế kỷ XIXTổ chức và hoạt động của Phòng Tư pháp từ thực tiễn tỉnh Phú Thọ (Luận văn thạc sĩ)BT Tieng anh 6 UNIT 2Tranh tụng tại phiên tòa hình sự sơ thẩm theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn xét xử của các Tòa án quân sự Quân khu (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtBÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘIĐổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt namHIỆU QUẢ CỦA MÔ HÌNH XỬ LÝ BÙN HOẠT TÍNH BẰNG KIỀMTÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲQUẢN LÝ VÀ TÁI CHẾ NHỰA Ở HOA KỲ