Báo cáo khoa học: A novel metallobridged bis(b-cyclodextrin)s fluorescent probe for the determination of glutathione doc

... centrifugation. The final plasma samples used in the determination of GSH were obtained. Determination of GSH in plasma and accuracy assessment by recovery experiments In order to evaluate the applicability ... (II) may lead to a significant fluorescence recovery of the bis(b-CD)s. Therefore, a rapid and simple spectrofluorimetric method was developed for the determinat...

Ngày tải lên: 07/03/2014, 05:20

... from the human trypsinogen prepro sequence was amplified from human pancreatic cDNA using the primer set (forward, CCCA AGCTTACCATGAATCTACTCCTGAT; reverse, GTTG GTACCTTGTCATCATCATCAAAGG), and inserted ... 7 (TACACACCCTGACCCGCATC) and 6 as template. Sequence analysis The sequence of the cDNA was analyzed using genetyx software (Software Development Co. Ltd, Tokyo, Japan). A novel...

Ngày tải lên: 16/03/2014, 23:20

... recent advances in the field of statistical machine learning (mul- tivariate capabilities of Support Vector Machines) and a rich feature space. RST offers a formal framework for hierarchical text ... through manual annotation (our gold standard). Standard performance indicators for such a task are precision, recall and F-score as measured by the PARSEVAL metrics (Black et al....

Ngày tải lên: 30/03/2014, 23:20

... 47th Annual Meet- ing of the Association for Computational Linguistics and the 4th International Joint Conference on Natu- ral Language Processing of the Asian Federation of Natural Language Processing ... fact that these events are not independent; the counts of one trigram can affect the probability of later ones, and moreover, the table assignment for the trigra...

Ngày tải lên: 17/03/2014, 00:20

... Shane Bergsma, Sittichai Jiampojamarn and Grzegorz Kondrak Department of Computing Science University of Alberta Edmonton, AB, T6G 2E8, Canada {qdou,bergsma,sj,kondrak}@cs.ualberta.ca Abstract Correct ... Proceedings of the 47th Annual Meeting of the ACL and the 4th IJCNLP of the AFNLP, pages 118–126, Suntec, Singapore, 2-7 August 2009. c 2009 ACL and AFNLP A Ranking Appr...

Ngày tải lên: 23/03/2014, 16:21

... interaction with their membranes. Materials and methods Materials All chemicals were of the purest analytical grade available. Proteases, aprotinin, lysozyme, and a- casein were from Sigma-Aldrich. ... protease inhibitor type of Kazal proteins. In particular, PSKP-1 is 48% identical to the inhibitor of acrosin – the major protease of mammalian spermatozoa – from the crab-eati...

Ngày tải lên: 30/03/2014, 13:20

... in all but the trivial case of measurements, whereas the non- compositional approach guarantees at least assimi- lation completeness for a subset of the parameters in the system. This means ... that the compositional ap- proach is contraindicated for all conceivable systems. In addition to the general theoretical appeal of com- positional semantics, the composi...

Ngày tải lên: 01/04/2014, 00:20

... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... of the FNR (Fig. 5A) . The Fdx ⁄ CYP17 5A1 ratio was saturated at 8 : 1, and the turnover rate at an Fdx ⁄ CYP17 5A1 ratio of 8 : 1 was 4.9-fold greater than that at a ratio o...

Ngày tải lên: 18/02/2014, 08:20

... 5¢-AAGTAGGCGGAGTATCGAAC-3¢ (sense) and 5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primers for unmethylated DNA were: 5¢-GAAGTAGGTGGAGT ATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCT ACTT-3¢ (antisense). Caspase 3 activity Cells ... intensity was determined using imagemaster 2d elite software 4.01 (Amersham Bioscience, Uppsala, Sweden). Statistical analysis Data in bar graphs are expressed as the...

Ngày tải lên: 18/02/2014, 18:20

... 8, 459–467. 10 Kanda A, Iwakoshi-Ukena E, Takuwa-Kuroda K & Minakata H (2003) Isolation and characterization of novel tachykinins from the posterior salivary gland of the common octopus Octopus vulgaris. ... into tachykinin-related peptides, their receptors, and invertebrate tachykinins: a review. Zool Sci 5, 533–549. 7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy- ama M, M...

Ngày tải lên: 19/02/2014, 00:20