Báo cáo khoa học: Transmembrane helix 12 plays a pivotal role in coupling energy provision and drug binding in ABCB1 pot

Báo cáo khoa học: Transmembrane helix 12 plays a pivotal role in coupling energy provision and drug binding in ABCB1 pot

Báo cáo khoa học: Transmembrane helix 12 plays a pivotal role in coupling energy provision and drug binding in ABCB1 pot

... The Authors Journal compilation ª 2010 FEBS 3985 Transmembrane helix 12 plays a pivotal role in coupling energy provision and drug binding in ABCB1 Emily Crowley 1 , Megan L. O’Mara 2 , Ian D. ... the transmembrane domains and nucleotide -binding domains (NBDs) of ABCB1. The present investigation further addressed the role of TM12 in ABCB1 by charac...

Ngày tải lên: 06/03/2014, 22:21

12 380 0
Báo cáo khoa học: Acylation of lysophosphatidylcholine plays a key role in the response of monocytes to lipopolysaccharide ppt

Báo cáo khoa học: Acylation of lysophosphatidylcholine plays a key role in the response of monocytes to lipopolysaccharide ppt

... utilized two acyltransferase inhibitors. SK&F 98625, originally described as a CoA-independent acyltransferase inhibitor [16], was included as it inhibits both LPCAT and LPAAT in MonoMac 6 cells ... level of U 1A mRNA was similar in all samples as shown in Fig. 4A. This indicated equal extraction efficiency and that SK&F 98625 was not a general transcription inhibitor. T...

Ngày tải lên: 31/03/2014, 01:20

7 322 0
Tài liệu Báo cáo khoa học: Synchronization of Ca2+ oscillations: a capacitative (AC) electrical coupling model in neuroepithelium pptx

Tài liệu Báo cáo khoa học: Synchronization of Ca2+ oscillations: a capacitative (AC) electrical coupling model in neuroepithelium pptx

... with F-actin via b-catenin and a- catenin; b-catenin binds to cadherin and a- catenin, which in turn interacts with F-actin (Fig. 3A) [24]. Thus b-catenin plays a pivotal role in the regulation of ... in intracellular [Ca 2+ ], as described below. Synchronous increases in intracellular [Ca 2+ ] and disassembly of cadherin–catenin complexes The cytoplasmic domain of cad...

Ngày tải lên: 16/02/2014, 09:20

7 641 0
Tài liệu Báo cáo khoa học: Proteolysis of Pseudomonas exotoxin A within hepatic endosomes by cathepsins B and D produces fragments displaying in vitro ADP-ribosylating and apoptotic effects doc

Tài liệu Báo cáo khoa học: Proteolysis of Pseudomonas exotoxin A within hepatic endosomes by cathepsins B and D produces fragments displaying in vitro ADP-ribosylating and apoptotic effects doc

... occurring mainly within domain III of ETA -A. Cell-free endosomes preloaded in vivo with ETA intraluminally processed and extraluminally released intact ETA and ETA -A in vitro in a pH-dependent and ATP-dependent ... (h) AEEAFDLWNECAKACVLDLKDGVRSSRMSVDPAIADTNGQGVLHYSMVLEGGNDALKLAIDN ALSITSDGLTIRLEGGVEPNKPVRYSYTRQARGSWSLNWLVPIGHEKPSNIKVFIHELNAGN QLSHMSPIYTIEMGDELLAKLARDATFFVRAHE...

Ngày tải lên: 18/02/2014, 04:20

15 588 0
Tài liệu Báo cáo khoa học: Solution structure of hirsutellin A – new insights into the active site and interacting interfaces of ribotoxins docx

Tài liệu Báo cáo khoa học: Solution structure of hirsutellin A – new insights into the active site and interacting interfaces of ribotoxins docx

... N-terminal hairpin in HtA is intermediate between those in RNse T1 and a- sarcin, having 20 amino acids in HtA, 26 in a- sarcin and 12 in RNase T1. From a functional point of view, this reduction in length ... in HtA replaces a tyrosine of a- sarcin, and the aromatic ring of F126, close to the catalytic H113, replaces a leucine side chain in a- sarcin in a...

Ngày tải lên: 18/02/2014, 08:20

10 608 0
Báo cáo khoa học: Gc recruitment system incorporating a novel signal amplification circuit to screen transient protein-protein interactions pot

Báo cáo khoa học: Gc recruitment system incorporating a novel signal amplification circuit to screen transient protein-protein interactions pot

... the target Z I3 1A gene was amplified by PCR with primers 5¢-AAATA TAAAACGCTAGCGTCGACATGGCGC-3¢ and 5¢-AGC GTAAAGGATGGGGAAAG-3¢. The final ratio of target cells was determined by counting the number ... as various mating responses, including global changes in transcription, a reporter gene assay and mating selec- tion are available (Fig. 1A) [12] . Unlike stable interactions, however,...

Ngày tải lên: 05/03/2014, 23:20

9 537 0
Báo cáo khoa học: Inhibition of PI3K/Akt partially leads to the inhibition of PrPC-induced drug resistance in gastric cancer cells pdf

Báo cáo khoa học: Inhibition of PI3K/Akt partially leads to the inhibition of PrPC-induced drug resistance in gastric cancer cells pdf

... CTAGAAAAAGTTGCTGTACTCATCCATGTGTCATGGATGAGTACAGCAA PrP C RNAi2 Sense TTTGGTGATACACATCTGCTCAACATGAGCAGATGTGTATCACCTTTTT Antisense CTAGAAAAAGGTGATACACATCTGCTCATGTTGAGCAGATGTGTATCAC Akt RNAi Sense TTTGTAGTCATTGTCCTCCAGCACAGCTGGAGGACAATGACTACTTTTT Antisense ... CCCAAGCTTGGGATGGCGAACCTTGGCTGCT Antisense CGGGATCCTCCCACATCAGGAAGATGAGGA PrP C RNAi1 Sense TTTGTTGCTGTACTCATCCATGACACATGGATGAGTACAGCAACTTT...

Ngày tải lên: 07/03/2014, 03:20

10 448 0
Báo cáo khoa học: Detailed structure of lipid A isolated from lipopolysaccharide from the marine proteobacterium Marinomonas vaga ATCC 27119T pot

Báo cáo khoa học: Detailed structure of lipid A isolated from lipopolysaccharide from the marine proteobacterium Marinomonas vaga ATCC 27119T pot

... 2 and 2 ¢) and ester linked (at positions 3 and 3¢)(R)- 3- hydroxy and (R)-3-acyloxy fatty acids [7]. On the other hand, according t o data available so far, lipid A structural variants displaying ... such molecules. Keywords: fast-atom bombardment MS (FAB-M S); lipid A; marine proteobacteria; Marinomonas vaga;NMR. Gram-negative bacteria, along with classical membrane lipids based...

Ngày tải lên: 07/03/2014, 15:20

10 418 0
Báo cáo khoa học: Curcumin suppresses the dynamic instability of microtubules, activates the mitotic checkpoint and induces apoptosis in MCF-7 cells ppt

Báo cáo khoa học: Curcumin suppresses the dynamic instability of microtubules, activates the mitotic checkpoint and induces apoptosis in MCF-7 cells ppt

... 73–75. 5 Aggarwal BB, Kumar A & Bharti AC (2003) Antican- cer potential of curcumin: preclinical and clinical stud- ies. Anticancer Res 23, 363–398. 6 Dohare P, Garg P, Jain V, Nath C & Ray M ... localization of the kinesin protein Eg5 and induced monopolar spindle formation. Further, curcumin increased the accumulation of Mad2 and BubR1 at the kinetochores, indi- cating that...

Ngày tải lên: 23/03/2014, 03:20

12 372 0
Báo cáo khoa học: Suppression of microtubule dynamics by benomyl decreases tension across kinetochore pairs and induces apoptosis in cancer cells potx

Báo cáo khoa học: Suppression of microtubule dynamics by benomyl decreases tension across kinetochore pairs and induces apoptosis in cancer cells potx

... tension across kinetochore pairs and induces apoptosis in cancer cells K. Rathinasamy and D. Panda School of Biosciences and Bioengineering, Indian Institute of Technology Bombay, Mumbai, India Benomyl ... Inazawa J, Toh H & Nagata S (1998) Molecular cloning and char- acterization of human caspase-activated DNase. Proc Natl Acad Sci USA 95, 9123 – 9128 . 51 Skehan P, Storeng R,...

Ngày tải lên: 30/03/2014, 10:20

15 333 0
Từ khóa:
w