Báo cáo khoa học: Enhancing the protein production levels in Escherichia coli with a strong promoter potx
... primers TEHA1: ACACAGATCTCTGCA- GGGCACCCCAGGCTTTACA and TEHA2: ACACCC- ATGGAGCTTTCCTGTGTGAAATTGT, lacUV5 was amplified. TEHA3: ACACAGATCTCTGCAGTGAAATG- AGCTGTTGACAATTA and TEHA4: ACACCCATGGT- CTGTTTCCTGTG ... protein was obtained from the SDS ⁄ PAGE and western blotting analyses and com- pared with the data obtained when analyzing the same protein in vitro. Because eGFP does affe...
Ngày tải lên: 06/03/2014, 01:20
... wild-type a1 AT in a manner that was comparable with inhibition of cationic and anionic trypsins, demonstrating that Arg198 is the critical determinant of resistance against a1 AT (Fig. 2A, B). Figure 2A ... al. who in their seminal study list a1 AT as one of the proteinaceous inhibitors that are inactive against mesotrypsin (see Table 5 in [2]). Sequence alignments, crystal...
Ngày tải lên: 30/03/2014, 10:20
... 'synonyms' is the most appropriate for achieving the desired pragmatic goals: but this is necessary for high- quality machine translation and natural language genera- tion. Knowledge-based approaches ... Journal. The problem is, of course, that authors aren't always typical. A particular word might occur in a 'pat- tern' in which another synonym w...
Ngày tải lên: 22/02/2014, 03:20
Báo cáo khoa học: Heterologous synthesis of cytochrome c¢ by Escherichia coli is not dependent on the System I cytochrome c biogenesis machinery ppt
... mkriamitaltlcaaaahaDALKPEDKVKFRQAS mkhvlastaaglmalgl-assaiaAGLSPEEQIETRQAG mkklstlaalacmtvgsll-atsaqaQFAKPEDAVKYRQSA mrrvllatlmaalpaaaMAADAEHVVEARKGY (1) H. thermoluteolus (2) A. vinosum (3) A. ... FSLVALEFGPLAAM-AKGEMPYDAAAAKAHASDLVTLTKYDPSDLYAPGTSAD-DVKGTA LKENFFQEQDEVRKIATNFVEQANKLAEVAAMGDKDEIKAQFGEVGKACKACHEKFREEE VKPEFFQNMEDVGKIAREFVGAANTLAEVAATGEAEAVKTAFGDVGAACKSCHEKYRAK- ARPEIWSDA...
Ngày tải lên: 06/03/2014, 00:20
Báo cáo khoa học: "Relieving The Data Acquisition Bottleneck In Word Sense Disambiguation" ppt
... occurrence in the specified context of the target word. 3.1.1 Manually Annotated Training Data The manually-annotated training data is the SEN- SEVAL2 Lexical Sample training data for the En- glish task, ... lines of 1734001 tokens The SALAAM-tagged corpora are rendered in a format similar to that of the manually annotated training data. The automatic sense tagging for MT...
Ngày tải lên: 08/03/2014, 04:22
Báo cáo khoa học: On the reaction of D-amino acid oxidase with dioxygen: O2 diffusion pathways and enhancement of reactivity docx
... by various approaches for the wild-type and W50 variants of DAAO. Table S2. Comparison of the ligand-binding properties and apparent steady-state kinetic parameters on d-alanine as substrate ... holoenzymes, as determined by gel-permeation chromatography and spectral analyses, and in the oxidized state show the typical spectrum of FAD-containing flavoproteins (i.e. absorbance maxima...
Ngày tải lên: 28/03/2014, 23:20
Tài liệu Báo cáo khoa học: Purified RPE65 shows isomerohydrolase activity after reassociation with a phospholipid membrane pdf
... cellular retinaldehyde-binding protein. After 2 h of incuba- tion at 37 °C in the dark, the generated retinoids were extracted with 300 lL of methanol and 300 lL of hexane and analyzed by normal-phase ... cell lysates, the production of 11-cis-retinol gradually decreased with increasing Chaps concentrations. When the Chaps-soluble fractions were used for the isomero- hydrol...
Ngày tải lên: 18/02/2014, 08:20
Báo cáo Y học: Oxidation of propionate to pyruvate in Escherichia coli Involvement of methylcitrate dehydratase and aconitase pot
... Forward primer Acs 5¢- TAATACGACTCACTATAGGGA*5¢-AACACACCATTCCTGCCAAC-3¢ CCACCACAGGTCGCGCC-3¢ AcnB 5¢- TAATACGACTCACTATAGGGA*5¢-CTCACACGCTGCTGATGTTC-3¢ CGTGGTTACGCACTTCACC-3¢ PrpD 5¢- TAATACGACTCACTATAGGGA*5¢-AACATCGGCGCGATGATCC-3¢ TCGCTGCTTCAACTGCCG-3 PrpE ... trans-aconitate, D -malate and L -malate, fumarate, maleate, D -tartrate and meso-tartrate, D -citramalate and L -citramalate, mesacon...
Ngày tải lên: 17/03/2014, 10:20
Tài liệu Báo cáo khoa học: Understanding the binding properties of an unusual metal-binding protein ) a study of bacterial frataxin pdf
... Medical Research Council. Journal compilation ª 2007 FEBS Understanding the binding properties of an unusual metal-binding protein ) a study of bacterial frataxin Chiara Pastore 1 , Marisa Franzese 2 , ... bleaching of the same peaks that are affected in the titration of the apoprotein. We observed, in par- ticular, the disappearance of residue 23. This suggests that Mn 2+ c...
Ngày tải lên: 18/02/2014, 16:20
Tài liệu Báo cáo khoa học: Gas6 and protein S Vitamin K-dependent ligands for the Axl receptor tyrosine kinase subfamily pptx
... for activated protein C in the deg- radation of clotting factors Va and VIIIa [5]. Gas6 has the same domain organization as protein S, namely an N-terminal region containing 11 c-carboxyglutamic acid ... disease [31]. Significantly, warfarin administration at subclini- cal doses inhibits these increases, further supporting the involvement of vitamin K (and Gas6) in the dis- eas...
Ngày tải lên: 19/02/2014, 05:20