Báo cáo khoa học: Enhancing the protein production levels in Escherichia coli with a strong promoter potx

... primers TEHA1: ACACAGATCTCTGCA-GGGCACCCCAGGCTTTACA and TEHA2: ACACCC-ATGGAGCTTTCCTGTGTGAAATTGT, lacUV5 wasampliﬁed. TEHA3: ACACAGATCTCTGCAGTGAAATG-AGCTGTTGACAATTA and TEHA4: ACACCCATGGT-CTGTTTCCTGTG ... protein was obtained from the SDS ⁄ PAGE and western blotting analyses and com-pared with the data obtained when analyzing the same protein in vitro. Because eGFP does affect the solubil-ity, the ... SwedenIntroductionRecombinant protein production in bacteria represents a common strategy for obtaining large amounts of a protein of interest. Although the use of Escherichia coli has a long tradition...

Báo cáo khoa học: Human mesotrypsin exhibits restricted S1¢ subsite speciﬁcity with a strong preference for small polar side chains docx

... wild-type a1 AT in a manner that wascomparable with inhibition of cationic and anionictrypsins, demonstrating that Arg198 is the criticaldeterminant of resistance against a1 AT (Fig. 2A, B).Figure 2A ... al. who in their seminal study list a1 AT as one of the proteinaceous inhibitors that are inactive againstmesotrypsin (see Table 5 in [2]). Sequence alignments,crystallographic data and mutagenesis ... Brilliant Blue staining. The positions of the bands representing the covalent complex, the free a1 AT and the free trypsins are indicated. a1 AT* indicates the cleaved, inac-tive a1 AT Pittsburgh....

Tài liệu Báo cáo khoa học: "Choosing the Word Most Typical in Context Using a Lexical Co-occurrence Network" ppt

... 'synonyms' is the most appropriate for achieving the desired pragmatic goals: but this is necessary for high- quality machine translation and natural language genera- tion. Knowledge-based approaches ... Journal. The problem is, of course, that authors aren't always typical. A particular word might occur in a 'pat- tern' in which another synonym was seen more often, making it the ... program to the baseline of always choosing the most frequent synonym according to the training corpus. But what are the 'correct' responses? Ideally, they should be chosen by a credible...

Báo cáo khoa học: Heterologous synthesis of cytochrome c¢ by Escherichia coli is not dependent on the System I cytochrome c biogenesis machinery ppt

... mkriamitaltlcaaaahaDALKPEDKVKFRQAS mkhvlastaaglmalgl-assaiaAGLSPEEQIETRQAGmkklstlaalacmtvgsll-atsaqaQFAKPEDAVKYRQSA mrrvllatlmaalpaaaMAADAEHVVEARKGY(1) H. thermoluteolus(2) A. vinosum(3) A. ... FSLVALEFGPLAAM-AKGEMPYDAAAAKAHASDLVTLTKYDPSDLYAPGTSAD-DVKGTALKENFFQEQDEVRKIATNFVEQANKLAEVAAMGDKDEIKAQFGEVGKACKACHEKFREEEVKPEFFQNMEDVGKIAREFVGAANTLAEVAATGEAEAVKTAFGDVGAACKSCHEKYRAK-ARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKKKAKAAIWQDADGFQAKGMAFFEAVAALEPAAGAGQKE-LAAAVGKVGGTCKSCHDDFRVKR* ... FSLVALEFGPLAAM-AKGEMPYDAAAAKAHASDLVTLTKYDPSDLYAPGTSAD-DVKGTALKENFFQEQDEVRKIATNFVEQANKLAEVAAMGDKDEIKAQFGEVGKACKACHEKFREEEVKPEFFQNMEDVGKIAREFVGAANTLAEVAATGEAEAVKTAFGDVGAACKSCHEKYRAK-ARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKKKAKAAIWQDADGFQAKGMAFFEAVAALEPAAGAGQKE-LAAAVGKVGGTCKSCHDDFRVKR* ** * ** * * *Fig. 2. Multiple sequence analysis of biochemically characterized...

Báo cáo khoa học: "Relieving The Data Acquisition Bottleneck In Word Sense Disambiguation" ppt

... occurrence in the speciﬁed context of the target word.3.1.1 Manually Annotated Training Data The manually-annotated training data is the SEN-SEVAL2 Lexical Sample training data for the En-glish task, ... lines of 1734001 tokens The SALAAM-tagged corpora are rendered in a format similar to that of the manually annotatedtraining data. The automatic sense tagging forMT and SV2LS TR training data ... is a special characteristic of the SALAAM-tagged training data, since the source of evidencefor SALAAM tagging is multilingual translations.STE measures the amount of translational variationfor...

Báo cáo khoa học: On the reaction of D-amino acid oxidase with dioxygen: O2 diffusion pathways and enhancement of reactivity docx

... by various approaches for the wild-typeand W50 variants of DAAO.Table S2. Comparison of the ligand-binding propertiesand apparent steady-state kinetic parameters ond-alanine as substrate ... holoenzymes, as determined bygel-permeation chromatography and spectral analyses,and in the oxidized state show the typical spectrum ofFAD-containing ﬂavoproteins (i.e. absorbance maximaat  455 and ... concentrations; Scheme 1 and Table 1)show a decrease in kcatfor all the variants with the exception of the T201V DAAO; the variant with the lowest kcatis the W50P DAAO (compare traces in Fig....

Tài liệu Báo cáo khoa học: Puriﬁed RPE65 shows isomerohydrolase activity after reassociation with a phospholipid membrane pdf

... cellular retinaldehyde-binding protein. After 2 h of incuba-tion at 37 °C in the dark, the generated retinoids wereextracted with 300 lL of methanol and 300 lL of hexaneand analyzed by normal-phase ... celllysates, the production of 11-cis-retinol graduallydecreased with increasing Chaps concentrations. When the Chaps-soluble fractions were used for the isomero-hydrolase assay, an initial plateau ... such as the recentﬁnding that binding to lipid membranes induces a con-formational change in Bax protein [23]. This couldexplain why RPE65 cannot catalyze the conversion ofall-trans-retinyl...

Báo cáo Y học: Oxidation of propionate to pyruvate in Escherichia coli Involvement of methylcitrate dehydratase and aconitase pot

... Forward primerAcs 5¢-TAATACGACTCACTATAGGGA*5¢-AACACACCATTCCTGCCAAC-3¢CCACCACAGGTCGCGCC-3¢AcnB 5¢-TAATACGACTCACTATAGGGA*5¢-CTCACACGCTGCTGATGTTC-3¢CGTGGTTACGCACTTCACC-3¢PrpD 5¢-TAATACGACTCACTATAGGGA*5¢-AACATCGGCGCGATGATCC-3¢TCGCTGCTTCAACTGCCG-3PrpE ... trans-aconitate,D-malate andL-malate, fumarate, maleate,D-tartrate and meso-tartrate,D-citramalate andL-citramalate,mesaconate, citraconate, itaconate, and (R,S)-3-methylitaconate.SubstrateConcentration(mM)ActivityUÆmg)1%(2S,3S)-Methylcitrate ... N-terminal glutamine, and modiﬁca-tion of cysteine by carbamidomethylation as well as partialcleavage leaving a maximum of one internal site uncleaved.RNA isolation and Northern blotE. coli...

Tài liệu Báo cáo khoa học: Understanding the binding properties of an unusual metal-binding protein ) a study of bacterial frataxin pdf

... Medical Research Council. Journal compilation ª 2007 FEBSUnderstanding the binding properties of an unusualmetal-binding protein ) a study of bacterial frataxinChiara Pastore1, Marisa Franzese2, ... bleaching of the same peaks that are affected in the titration of the apoprotein. We observed, in par-ticular, the disappearance of residue 23. This suggeststhat Mn2+can displace Ca2+at ... broad-ening, indicating a change of the chemical environmentaround the binding site upon binding of the dia-magnetic Ca2+(Fig. 2C). No other resonances wereaffected at higher ratios, and the...

Tài liệu Báo cáo khoa học: Gas6 and protein S Vitamin K-dependent ligands for the Axl receptor tyrosine kinase subfamily pptx

... for activated protein C in the deg-radation of clotting factors Va and VIIIa [5]. Gas6 has the same domain organization as protein S, namely anN-terminal region containing 11 c-carboxyglutamicacid ... disease[31]. Signiﬁcantly, warfarin administration at subclini-cal doses inhibits these increases, further supporting the involvement of vitamin K (and Gas6) in the dis-ease aetiology. In addition, ... species, with only the bovine variant clearly activating human Sky [54]. In this regard, we have utilized domain swapping andmutational approaches to advantage to show similarreceptor-binding features...

Xem thêm