0
  1. Trang chủ >
  2. Luận Văn - Báo Cáo >
  3. Báo cáo khoa học >

Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor docx

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... 277 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... purchased from Toyobo (Osaka, Japan). Emul-gen 911 was a gift from Kao Chemical (Tokyo, Japan).NADPH, NADH and NADP+were purchased fromOriental Yeast (Tokyo, Japan). a- Cyano-4-hydroxycinnamicacid ... 106 NAYTAKAVIIAAGVGAFEPRRIGAPGEREFEGRGVYYAVKSKA-EFQGK-RVLIVGGGDS 163E. coli 103 -EYTCDALIIATGASA RYLGLPSEEAFKGRGVSACATCDG-FFYRNQKVAVIGGGNT 157 A. pernix 115 LEVKARTVILAVGSRR RKLGVPGEAELAGRGVSYCSVCDAPLFKGKDAVVVVGGGDS...
  • 14
  • 617
  • 0
Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx

Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx

... (sense) and5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primersfor unmethylated DNA were: 5¢-GAAGTAGGTGGAGTATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCTACTT-3¢ (antisense).Caspase 3 activityCells ... intensity was determined using imagemaster2d elite software 4.01 (Amersham Bioscience, Uppsala,Sweden).Statistical analysisData in bar graphs are expressed as the mean and standarddeviation of ... caspase assay were seeded on a 24-well plate and transfected with FuGENE 6. The caspaseassay was performed using the CaspACE colorimetric assaykit as described by the manufacturer (Promega)....
  • 12
  • 613
  • 0
Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt

Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt

... tachykinins: a review. Zool Sci 5,533–549.7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy-ama M, Minakata H, Chiba T, Metoki H, Satou Y &Satoh N (2004) Tachykinin and tachykinin receptor ofan ascidian, ... vulgaris).Biochem J 387, 85–91.25 Kanda A, Takahashi T, Satake H & Minakata H (2006)Molecular and functional characterization of a novel gonadotropin-releasing-hormone receptor isolated ... Kyoko Takuwa-Kuroda, Masato Aoyama and Honoo SatakeSuntory Institute for Bioorganic Research, Osaka, JapanTachykinins (TKs) are vertebrate multifunctional brain ⁄gut peptides involved in various...
  • 11
  • 595
  • 0
Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt

Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt

... CumOOH, and NADPHwere also obtained from Sigma. Sephadex G-25 was pur-chased from Pharmacia (Uppsala, Sweden). All the othermaterials were of analytical grade and obtained fromBeijing Chemical ... swelling and a decrease in mitochondria integrity.TBARS content in ferrous sulfate ⁄ ascorbate-treatedmitochondria was analyzed by thiobarbituric acid assay[34]. In this assay, thiobarbituric acid ... such asinstability, antigenicity and poor availability, muchattention has been paid to its artificial imitation [9,10].In synthetic approaches, an initial attempt is madeto synthesize organoselenium...
  • 9
  • 491
  • 0
Tài liệu Báo cáo khoa học: A novel type of highly negatively charged lipooligosaccharide from Pseudomonas stutzeri OX1 possessing two 4,6-O-(1-carboxy)-ethylidene residues in the outer core region ppt

Tài liệu Báo cáo khoa học: A novel type of highly negatively charged lipooligosaccharide from Pseudomonas stutzeri OX1 possessing two 4,6-O-(1-carboxy)-ethylidene residues in the outer core region ppt

... Gram-negative bacteria, and their adaptability tomany different pollutants [1].Pseudomonas stutzeri OX1 is a Gram-negative bacteriumisolated from the activated sludge of a wastewater treatmentplant, ... Viviana Izzo2, Alba Silipo1, Luisa Sturiale3, Domenico Garozzo3, Rosa Lanzetta1,Michelangelo Parrilli1, Antonio Molinaro1and Alberto Di Donato21Dipartimento di Chimica Organica ... & Brade, H. (1994) Preparationand structural analysis of oligosaccharide monophosphatesobtained from the lipopolysaccharide of recombinant strains ofSalmonella minnesota and Escherichia coli...
  • 14
  • 715
  • 0
Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc

Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc

... (Osaka, Japan); meatextract (Extract Ehlrich) w as from Kyokuto Seiyaku Kogyo(Osaka, Japan); and pentafluorophenylhydrazine was fromPfaltz & Bauer. (Waterbury, CT, USA). DE52 cellulose wasfrom ... only as a carbon source, but also as a nitrogensource for g rowth of the assimilating bacteria. Deaminases,which catalyze the release of ammonia, are a key enzyme inthe metabolic pathways of ... Decarboxylation has a concertedmechanism with an aromatic t ransition state. 2-hydroxy-5-carboxymuconic 6 -semialdehyde has an aldehyde groupand a C-5 carboxyl group, which is a 3-ketoacid. As...
  • 7
  • 613
  • 1
Tài liệu Báo cáo khoa học: A novel c-N-methylaminobutyrate demethylating oxidase involved in catabolism of the tobacco alkaloid nicotine by Arthrobacter nicotinovorans pAO1 ppt

Tài liệu Báo cáo khoa học: A novel c-N-methylaminobutyrate demethylating oxidase involved in catabolism of the tobacco alkaloid nicotine by Arthrobacter nicotinovorans pAO1 ppt

... man-made organic compounds, among them thetobacco alkaloid nicotine. Perhaps analysed in greatestdetail is the pathway of nicotine degradation as it takesplace in Arthrobacter nicotinovorans ... c-N-methylamino-butyrate oxidase; megaplasmid pAO1; nicotine degradation;sarcosine o xidase.The bacterial soil community plays a pivotal role in thebiodegradation of a n a lmost unlimited spectrum of naturaland ... 5¢-GACCTGAGTAGAAATGGATCCCTGA TGGACAGG-3¢and 5¢-GGAATGGCTCGAGGGATCATCACC-3¢ bear-ing the restriction e nzyme recognition sites Bam HI andXhoI, respectively. pAO1 DNA, isolated as describedpreviously...
  • 8
  • 647
  • 0
Tài liệu Báo cáo khoa học:

Tài liệu Báo cáo khoa học: "A Novel Feature-based Approach to Chinese Entity Relation Extraction" ppt

... tree-kernel approaches are not suitable for Chinese, at least at current stage. In this paper, we study a feature-based approach that basically integrates entity related information with context ... extraction has been extensively studied in English over the past years. It is typically cast as a classification problem. Existing approaches include feature-based and kernel-based classification. ... are used as feature, and a classifier is trained for each relation type and subtype; (2) similar to (1) but all nine structures are concerned; and (3) similar to (2) but the training data...
  • 4
  • 479
  • 0
Tài liệu Báo cáo khoa học: A novel nuclear DNA helicase with high specific activity from Pisum sativum catalytically translocates in the 3¢fi5¢ direction docx

Tài liệu Báo cáo khoa học: A novel nuclear DNA helicase with high specific activity from Pisum sativum catalytically translocates in the 3¢fi5¢ direction docx

... HDH,human DNA helicase; eIF-4 A, eukaryotic translation initiation factor 4A. Property PDH45 a PDH65bPDH120Molecular mass: SDS/PAGE 45.5 kDa 65 kDa 54 and 66 kDaNative 45.5 kDa 65 kDa 120 kDaOligomeric ... 2A, lane 4) and ssDNA-dependentATPase activity (data not shown) sedimented togetherbetween alcohol dehydrogenase and BSA (fraction 11)and gave a molecular mass of 120 kDa with a sedimen-tation ... substrates (Fig. 5G and H) wereprepared as described previously [11,15].ATP-dependent DNA helicase and DNA-dependentATPase assaysThe standard DNA helicase reaction was performed in a 10-lL reaction...
  • 11
  • 573
  • 0
Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor docx

Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor docx

... 1CGACAGgtgagt)3069 bpÀcaacagGTATATIntron 2 TTTTGTgtaaat)146 bpÀcaacagGTATAAIntron 3 AGACGGgtatga)469 bpÀtttcagGTAGTGIntron 4 TGCCAGgtatgt)119 bpÀttccagATTCCGFig. 5. Schematic representation ... first-strand cDNA was amplified using thedegenerate primers 5¢-AI (A/ C)GIATG (A/ C)GIACIGTIACIAA(T/C)TA(T/C)TT-3¢ (I represents an inosine residue)and 5¢-CA (A/ G)CA (A/ G)TAIATIGG (A/ G)TT (A/ G)TACAT-3¢, ... reactions(RT-PCRs) and rapid amplifications of cDNA ends wereperformed using TaqExpolymerase (Takara, Kyoto, Japan)or rTaq DNA polymerase (Toyobo, Osaka, Japan) and a thermal cycler (model GeneAmp PCR...
  • 9
  • 472
  • 0

Xem thêm

Từ khóa: tài liệu báo cáo khoa học bản chất của khủng hoảng kinh tế thế giới pdftài liệu báo cáo thực tập trạm biến áp phần ii docxtài liệu báo cáo nghiên cứu khoa họctài liệu về báo cáo khoa họcbáo cáo khoa học công nghệ phục vụ nông nghiệp và phát triển nông thôn các tỉnh phía bắc 2006 2007 tài liệu phục vụ hội nghị10 trần thị luyến và cộng sự hoàn thiện quy trình sản xuất chitin chitosan và chế biến một số sản phẩm công nghiệp từ phế liệu vỏ tôm cua báo cáo khoa học đề tài cấp bộ nha trang 2000nghiên cứu các tài liệu báo cáo của các nhà nghiên cứu đi trước về các lập luận khoa học về trồng và phòng bệnh dịch cho hoa hồng cách quản lý sử dụng phân bón đúng cách vvbáo cáo khoa học tài chính côngbáo cáo khoa học số loài quý hiếm tại vườn quốc gia ba bểtai lieu bao cao thuc tap khoa co khitai lieu bao cao thuc tap tai khoa duoc benh vientai lieu bao cao thuc tap y si da khoabáo cáo khoa học ảnh hưởng của tuổi thu hoạch đến năng suất và chất lượng thức ăn của cỏ voi pennisetum purpureum cỏ ghi nê panicum maximum trồng tại đan phượng hà tây pptxtai lieu bao cao thuc tap tim hieu nhan cach mot hoc sinhbáo cáo khoa học về nghệ thuật trong lieu trai chi diNghiên cứu sự biến đổi một số cytokin ở bệnh nhân xơ cứng bì hệ thốngBáo cáo quy trình mua hàng CT CP Công Nghệ NPVNghiên cứu sự hình thành lớp bảo vệ và khả năng chống ăn mòn của thép bền thời tiết trong điều kiện khí hậu nhiệt đới việt namMột số giải pháp nâng cao chất lượng streaming thích ứng video trên nền giao thức HTTPNghiên cứu tổ chức chạy tàu hàng cố định theo thời gian trên đường sắt việt namPhát triển du lịch bền vững trên cơ sở bảo vệ môi trường tự nhiên vịnh hạ longPhát hiện xâm nhập dựa trên thuật toán k meansNghiên cứu về mô hình thống kê học sâu và ứng dụng trong nhận dạng chữ viết tay hạn chếNghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúngNghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000Thiết kế và chế tạo mô hình biến tần (inverter) cho máy điều hòa không khíKiểm sát việc giải quyết tố giác, tin báo về tội phạm và kiến nghị khởi tố theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn tỉnh Bình Định (Luận văn thạc sĩ)Tăng trưởng tín dụng hộ sản xuất nông nghiệp tại Ngân hàng Nông nghiệp và Phát triển nông thôn Việt Nam chi nhánh tỉnh Bắc Giang (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtchuong 1 tong quan quan tri rui roGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtTrách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)BÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘIChiến lược marketing tại ngân hàng Agribank chi nhánh Sài Gòn từ 2013-2015MÔN TRUYỀN THÔNG MARKETING TÍCH HỢP