... 277 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... purchased from Toyobo (Osaka, Japan). Emul- gen 911 was a gift from Kao Chemical (Tokyo, Japan). NADPH, NADH and NADP + were purchased from Oriental Yeast (Tokyo, Japan). a- Cyano-4...
Ngày tải lên: 18/02/2014, 08:20
... (sense) and 5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primers for unmethylated DNA were: 5¢-GAAGTAGGTGGAGT ATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCT ACTT-3¢ (antisense). Caspase 3 activity Cells ... intensity was determined using imagemaster 2d elite software 4.01 (Amersham Bioscience, Uppsala, Sweden). Statistical analysis Data in bar graphs are expressed as the mean and standard deviation o...
Ngày tải lên: 18/02/2014, 18:20
Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt
... tachykinins: a review. Zool Sci 5, 533–549. 7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy- ama M, Minakata H, Chiba T, Metoki H, Satou Y & Satoh N (2004) Tachykinin and tachykinin receptor of an ascidian, ... vulgaris). Biochem J 387, 85–91. 25 Kanda A, Takahashi T, Satake H & Minakata H (2006) Molecular and functional characterization of a novel gonadotropin-releasing-hor...
Ngày tải lên: 19/02/2014, 00:20
Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt
... CumOOH, and NADPH were also obtained from Sigma. Sephadex G-25 was pur- chased from Pharmacia (Uppsala, Sweden). All the other materials were of analytical grade and obtained from Beijing Chemical ... swelling and a decrease in mitochondria integrity. TBARS content in ferrous sulfate ⁄ ascorbate-treated mitochondria was analyzed by thiobarbituric acid assay [34]. In this assay, thiobarbitur...
Ngày tải lên: 19/02/2014, 02:20
Tài liệu Báo cáo khoa học: A novel type of highly negatively charged lipooligosaccharide from Pseudomonas stutzeri OX1 possessing two 4,6-O-(1-carboxy)-ethylidene residues in the outer core region ppt
... Gram-negative bacteria, and their adaptability to many different pollutants [1]. Pseudomonas stutzeri OX1 is a Gram-negative bacterium isolated from the activated sludge of a wastewater treatment plant, ... Viviana Izzo 2 , Alba Silipo 1 , Luisa Sturiale 3 , Domenico Garozzo 3 , Rosa Lanzetta 1 , Michelangelo Parrilli 1 , Antonio Molinaro 1 and Alberto Di Donato 2 1 Dipartimento di Chimic...
Ngày tải lên: 19/02/2014, 13:20
Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc
... (Osaka, Japan); meat extract (Extract Ehlrich) w as from Kyokuto Seiyaku Kogyo (Osaka, Japan); and pentafluorophenylhydrazine was from Pfaltz & Bauer. (Waterbury, CT, USA). DE52 cellulose was from ... only as a carbon source, but also as a nitrogen source for g rowth of the assimilating bacteria. Deaminases, which catalyze the release of ammonia, are a key enzyme in the metabolic pat...
Ngày tải lên: 19/02/2014, 16:20
Tài liệu Báo cáo khoa học: A novel c-N-methylaminobutyrate demethylating oxidase involved in catabolism of the tobacco alkaloid nicotine by Arthrobacter nicotinovorans pAO1 ppt
... man-made organic compounds, among them the tobacco alkaloid nicotine. Perhaps analysed in greatest detail is the pathway of nicotine degradation as it takes place in Arthrobacter nicotinovorans ... c-N-methylamino- butyrate oxidase; megaplasmid pAO1; nicotine degradation; sarcosine o xidase. The bacterial soil community plays a pivotal role in the biodegradation of a n a lmost unlimited...
Ngày tải lên: 19/02/2014, 16:20
Tài liệu Báo cáo khoa học: "A Novel Feature-based Approach to Chinese Entity Relation Extraction" ppt
... tree-kernel approaches are not suitable for Chinese, at least at current stage. In this paper, we study a feature-based approach that basically integrates entity related information with context ... extraction has been extensively studied in English over the past years. It is typically cast as a classification problem. Existing approaches include feature-based and kernel-based clas...
Ngày tải lên: 20/02/2014, 09:20
Tài liệu Báo cáo khoa học: A novel nuclear DNA helicase with high specific activity from Pisum sativum catalytically translocates in the 3¢fi5¢ direction docx
... HDH, human DNA helicase; eIF-4 A, eukaryotic translation initiation factor 4A. Property PDH45 a PDH65 b PDH120 Molecular mass: SDS/PAGE 45.5 kDa 65 kDa 54 and 66 kDa Native 45.5 kDa 65 kDa 120 kDa Oligomeric ... 2A, lane 4) and ssDNA-dependent ATPase activity (data not shown) sedimented together between alcohol dehydrogenase and BSA (fraction 11) and gave a molecular mass of 120 kDa wit...
Ngày tải lên: 20/02/2014, 11:20
Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor docx
... 1 CGACAGgtgagt)3069 bpÀcaacagGTATAT Intron 2 TTTTGTgtaaat)146 bpÀcaacagGTATAA Intron 3 AGACGGgtatga)469 bpÀtttcagGTAGTG Intron 4 TGCCAGgtatgt)119 bpÀttccagATTCCG Fig. 5. Schematic representation ... first-strand cDNA was amplified using the degenerate primers 5¢-AI (A/ C)GIATG (A/ C)GIACIGTIA CIAA(T/C)TA(T/C)TT-3¢ (I represents an inosine residue) and 5¢-CA (A/ G)CA (A/ G)TAIATIGG (A/ G)TT (A/...
Ngày tải lên: 21/02/2014, 03:20