Tài liệu Báo cáo khoa học: Separation of a cholesterol-enriched microdomain involved in T-cell signal transduction doc

Tài liệu Báo cáo khoa học: Separation of a cholesterol-enriched microdomain involved in T-cell signal transduction doc

Tài liệu Báo cáo khoa học: Separation of a cholesterol-enriched microdomain involved in T-cell signal transduction doc

... Ohno-Iwashita Y, Shimada Y, Waheed AA, Hayashi M, Inomata M, Nakamura M, Maruya M & Iwashita S (2004) Perfringolysin O, a cholesterol-binding cytolysin, as a probe for lipid rafts. Anaerobe ... involved in segregating signalling molecules from each other to maintain the ‘off’ state of T-cell signalling. Taken together, the BCh-bound cholesterol-enriched subpopulation contain...
Ngày tải lên : 20/02/2014, 03:20
  • 10
  • 588
  • 0
Tài liệu Báo cáo khoa học: Modulation of a-synuclein aggregation by dopamine in the presence of MPTP and its metabolite pptx

Tài liệu Báo cáo khoa học: Modulation of a-synuclein aggregation by dopamine in the presence of MPTP and its metabolite pptx

... substantia nigra pars compacta and appearance of Lewy bodies consisting of aggregated protein, mainly a- synuclein, in Keywords amyloid; fibrillation; Parkinson’s disease; synuclein; thioflavin T Correspondence I. ... H, Okamura K, Bauer PO, Furukawa Y, Shimizu H, Kurosawa M, Machida Y, Miyazaki H, Mitsui K, Kuroiwa Y et al. (2008) RNA-binding protein TLS is a major nuclear aggregate-i...
Ngày tải lên : 14/02/2014, 19:20
  • 11
  • 754
  • 0
Tài liệu Báo cáo khoa học: Roles of AP-2 transcription factors in the regulation of cartilage and skeletal development doc

Tài liệu Báo cáo khoa học: Roles of AP-2 transcription factors in the regulation of cartilage and skeletal development doc

... RRHEDLLHGP-HA Beta HPWGQRQRQEVGSEAGSLLPQPRAALPQLSG-LDP RRDYHSVRRPDVLLHSAHHG Gamma QQAWPGRQSQEGAGLPSHHGRPAGLLPHLSG-LEAGAVSARRDAY RRSDLLLPHAHAL Epsilon QAAWAAPRAAARAHEE PPGLLAPPARALG-LDP RRDYA TAVPRLLHGLADG ... was shown that the broad-complex, tramtrack and bric -a- brac domain containing protein KCTD1 directly binds to AP- 2a and acts as a negative regulator for AP- 2a trans- activatio...
Ngày tải lên : 16/02/2014, 09:20
  • 9
  • 642
  • 0
Tài liệu Báo cáo khoa học: Comparison of a coq7 deletion mutant with other respiration-defective mutants in fission yeast doc

Tài liệu Báo cáo khoa học: Comparison of a coq7 deletion mutant with other respiration-defective mutants in fission yeast doc

... GGGGATCCGTCGACCTGCAGCGTACGAGGAAAGGAAATAGGC cyc1-y GTTTAAACGAGCTCGAATTCATCGATCCGTCAACGACAGTTG cyc1-z GCATCAGAAAGCATAGGC cyc1-m TGGGAATACGATAGAGTAG nb2 primer GTTTAAACGAGCTCGAATTC Coq7 in fission yeast R. ... GGGGATCCGTCGACCTGCAGCGTACGACATACTACTTCATTTG Spcoq3-y GTTTAAACGAGCTCGAATTCATCGATCCTAGCGTTACCGTTG Spcoq3-z GTATGCGATGTGGAATTTG Spcoq3-m GATGCCTTCCAATGAATTAC cyc1-w GAACCAATGAAATAAGGGCG cyc1...
Ngày tải lên : 18/02/2014, 14:20
  • 16
  • 646
  • 0
Tài liệu Báo cáo khoa học: Development of a new method for isolation and long-term culture of organ-specific blood vascular and lymphatic endothelial cells of the mouse pdf

Tài liệu Báo cáo khoa học: Development of a new method for isolation and long-term culture of organ-specific blood vascular and lymphatic endothelial cells of the mouse pdf

... 5¢-CTC GAGATGGATAAAGTTTTAAACAGAG-3¢ and LTA- 1R, 5¢-TGAAGGCAAATCTCTGGAC-3¢ for the former, and LTA–M2F, 5¢-CAGCTGTTTTGCTTGAATTATG-3¢ and LTA–2R, 5¢-GAATTCATTATGTTTCAGGTTCA GGGG-3¢ for the latter. The ... lymphatic endothelial cells of the mouse Takashi Yamaguchi, Taeko Ichise, Osamu Iwata, Akiko Hori, Tomomi Adachi, Masaru Nakamura, Nobuaki Yoshida and Hirotake Ichise Laboratory of Gene E...
Ngày tải lên : 18/02/2014, 17:20
  • 11
  • 873
  • 0
Tài liệu Báo cáo khoa học: Glycation of low-density lipoprotein results in the time-dependent accumulation of cholesteryl esters and apolipoprotein B-100 protein in primary human monocyte-derived macrophages docx

Tài liệu Báo cáo khoa học: Glycation of low-density lipoprotein results in the time-dependent accumulation of cholesteryl esters and apolipoprotein B-100 protein in primary human monocyte-derived macrophages docx

... deposition. Proc Natl Acad Sci USA 76, 333–337. 7 Khaw KT, Wareham N, Bingham S, Luben R, Welch A & Day N (2004) Association of hemoglobin A1 c with cardiovascular disease and mortality in adults: the ... myeloperoxidase to convert alpha-amino acids to a battery of reactive aldehydes: a pathway for aldehyde generation at sites of in ammation. Biochemistry 37, 6864–6873. 57...
Ngày tải lên : 19/02/2014, 02:20
  • 12
  • 604
  • 0
Tài liệu Báo cáo khoa học: Application of a fluorescent cobalamin analogue for analysis of the binding kinetics A study employing recombinant human transcobalamin and intrinsic factor pdf

Tài liệu Báo cáo khoa học: Application of a fluorescent cobalamin analogue for analysis of the binding kinetics A study employing recombinant human transcobalamin and intrinsic factor pdf

... 4753 Application of a fluorescent cobalamin analogue for analysis of the binding kinetics A study employing recombinant human transcobalamin and intrinsic factor Sergey N. Fedosov 1 , Charles ... Haber E & Olesen H (1971) Nature of vitamin B 12 binding. II. Steric orientation of vitamin B 12 on binding and number of combining sites of human intrin- sic factor and the transc...
Ngày tải lên : 19/02/2014, 05:20
  • 12
  • 603
  • 0
Tài liệu Báo cáo khoa học: Characterization of a recombinantly expressed proteinase K-like enzyme from a psychrotrophic Serratia sp. ppt

Tài liệu Báo cáo khoa học: Characterization of a recombinantly expressed proteinase K-like enzyme from a psychrotrophic Serratia sp. ppt

... Miyamoto K, Tanaka K, Kawai M, Tainaka K, Imada C, Okami Y & Inamori Y (1993) Cloning and sequence of an alkaline serine protease-encoding gene from the marine bacterium Alteromonas sp. strain O-7. ... PCR was performed in 50 lL containing 1 ng of genomic DNA as template, 0.2 mm dATP, dCTP, dGTP and dTTP, 0.2 lm of upstream primer (OP17: 5¢-GA AAAACCATGGTGAATGAATACCAAGCGACT-3¢ ) a...
Ngày tải lên : 19/02/2014, 07:20
  • 14
  • 523
  • 0
Tài liệu Báo cáo khóa học: Suppression of b1,3galactosyltransferase b3Gal-T5 in cancer cells reduces sialyl-Lewis a and enhances poly N-acetyllactosamines and sialyl-Lewis x on O-glycans Lydia Mare and Marco Trinchera pdf

Tài liệu Báo cáo khóa học: Suppression of b1,3galactosyltransferase b3Gal-T5 in cancer cells reduces sialyl-Lewis a and enhances poly N-acetyllactosamines and sialyl-Lewis x on O-glycans Lydia Mare and Marco Trinchera pdf

... expressing an antisense fragment of b3Gal-T5 was obtained from the human pancreas adeno- carcinoma cell line BxPC3 and characterized. Both b1,3Gal- T activity and sLe a expression are dramatically ... pancreatic cells, counteracting the glycosylation pattern associated to malignancy. We found in fact that NeuAca2-3Galb1-3[Fuca1-4]Glc- NAcb1-3Gal and NeuAca2-3Galb1-3GlcNAcb1-3Gal are the...
Ngày tải lên : 19/02/2014, 12:20
  • 9
  • 460
  • 0
Tài liệu Báo cáo khoa học: Selection of stably folded proteins by phage-display with proteolysis docx

Tài liệu Báo cáo khoa học: Selection of stably folded proteins by phage-display with proteolysis docx

... library of target proteins between the N-terminal domain and the C-terminal (CT) domain allows a protease-based selection because proteolysis of the target protein also removes the N-terminal domains ... four-helix bundle protein in the absence of any cofactors. In this work, the authors used the method similar to that of Finucane et al. [11] except that the protein A B-domain...
Ngày tải lên : 19/02/2014, 12:20
  • 6
  • 444
  • 0