Tài liệu Báo cáo khoa học: Transcription of individual tRNA1Gly genes from within a multigene family is regulated by transcription factor TFIIIB pdf

Tài liệu Báo cáo khoa học: Transcription of individual tRNA1Gly genes from within a multigene family is regulated by transcription factor TFIIIB pdf

Tài liệu Báo cáo khoa học: Transcription of individual tRNA1Gly genes from within a multigene family is regulated by transcription factor TFIIIB pdf

... shut off. By contrast, when there is demand for large excesses of a particular type of tRNA, as in the PSG, and sufficient quantities of transcription factors are available, transcription from all ... transcription FEBS Journal 272 (2005) 5191–5205 ª 2005 FEBS 5205 Transcription of individual tRNA Gly 1 genes from within a multigene family is regulated...

Ngày tải lên: 20/02/2014, 02:21

15 484 0
Báo cáo khoa học: Expression of the Drosophila melanogaster ATP synthase a subunit gene is regulated by a transcriptional element containing GAF and Adf-1 binding sites pptx

Báo cáo khoa học: Expression of the Drosophila melanogaster ATP synthase a subunit gene is regulated by a transcriptional element containing GAF and Adf-1 binding sites pptx

... 4013 Expression of the Drosophila melanogaster ATP synthase a subunit gene is regulated by a transcriptional element containing GAF and Adf-1 binding sites Ana Talamillo 1, *, Miguel Angel Ferna ´ ndez-Moreno 1 , ... synthase and in particular the a- F1-ATPase and b-F1-ATPase catalytic subunits have been often used as markers for mitochondrial biogenesis [6,31,44,45]. The Drosoph...

Ngày tải lên: 07/03/2014, 16:20

11 532 0
Tài liệu Báo cáo khoa học: Characterization of electrogenic bromosulfophthalein transport in carnation petal microsomes and its inhibition by antibodies against bilitranslocase docx

Tài liệu Báo cáo khoa học: Characterization of electrogenic bromosulfophthalein transport in carnation petal microsomes and its inhibition by antibodies against bilitranslocase docx

... (1992) Spatial organization of enzymes in plant metabolic pathways. Annu Rev Plant Physiol Plant Mol Biol 43, 241–267. 4 Fujiwara H, Tanaka Y, Yonekura-Sakakibara K, Fuku- chi-Mizutani M, Nakao M, ... legitimate to apply the Scrutton and Utter equation [40] to the inhibition data. Data analyses Data were analysed by means of sigmaplot 2001 (SPSS Science Software Gmbh, Erkrath, Germany)....

Ngày tải lên: 20/02/2014, 01:20

15 589 0
Tài liệu Báo cáo khoa học: "Integration of Large-Scale Linguistic Resources in a Natural Language Understanding System" pdf

Tài liệu Báo cáo khoa học: "Integration of Large-Scale Linguistic Resources in a Natural Language Understanding System" pdf

... semantic analysis, and pragmatic analysis. Each stage has been designed to use linguistic data such as the lexicon and grammar, which are maintained separately from the engine, and can easily ... Integration of Large-Scale Linguistic Resources in a Natural Language Understanding System Lewis M. Norton, Deborah A. Dahl, Li Li, and Katharine P. Beals Unisys Corporation 2476 Swede...

Ngày tải lên: 20/02/2014, 18:20

5 417 0
Tài liệu Báo cáo khoa học: Roles of AP-2 transcription factors in the regulation of cartilage and skeletal development doc

Tài liệu Báo cáo khoa học: Roles of AP-2 transcription factors in the regulation of cartilage and skeletal development doc

... Analyses of AP- 2a- null mice have demonstrated that AP- 2a is a fundamental regulator of mammalian craniofacial development. AP- 2a knockout mice die perinatally with craniofacial defects, thoracoabdominoschisis, ... RRDYHSVRRPDVLLHSAHHG Gamma QQAWPGRQSQEGAGLPSHHGRPAGLLPHLSG-LEAGAVSARRDAY RRSDLLLPHAHAL Epsilon QAAWAAPRAAARAHEE PPGLLAPPARALG-LDP RRDYA TAVPRLLHGLADG Delta IHHGEPTD...

Ngày tải lên: 16/02/2014, 09:20

9 642 0
Tài liệu Báo cáo khoa học: Characterization of human deoxyribonuclease I gene (DNASE1) promoters reveals the utilization of two transcription-starting exons and the involvement of Sp1 in its transcriptional regulation ppt

Tài liệu Báo cáo khoa học: Characterization of human deoxyribonuclease I gene (DNASE1) promoters reveals the utilization of two transcription-starting exons and the involvement of Sp1 in its transcriptional regulation ppt

... Journal compilation ª 2006 FEBS 6 Shiokawa D & Tanuma S (2001) Characterization of human DNase I family endonucleases and activation of DNase c during apoptosis. Biochemistry 40, 143–152. 7 Nadano ... Y, Yamamoto F & Takizawa H (2002) Characterization of the human ABO gene pro- moter in erythroid cell lineage. Vox Sang 82, 39–46. 34 Yasuda T, Awazu S, Sato W, Iida R, Tanaka Y...

Ngày tải lên: 19/02/2014, 06:20

12 610 0
Tài liệu Báo cáo khoa học: Role of transcription factor activator protein 1 (AP1) in epidermal growth factor-mediated protection against apoptosis induced by a DNA-damaging agent doc

Tài liệu Báo cáo khoa học: Role of transcription factor activator protein 1 (AP1) in epidermal growth factor-mediated protection against apoptosis induced by a DNA-damaging agent doc

... pbabePuro, and J. Takino, M. Tagawa, and K. Uchida for technical assistance. This work was supported in part by a grant from the program Grants-in-Aid for Young Scientists of the Ministry of ... Healthcare). Caspase 9 activity assay Caspase 9 activity was examined according to the instruc- tion manual of the Caspase 9 ⁄ Mch6 Fluorometric Protease Assay kit (Medical and Biological...

Ngày tải lên: 19/02/2014, 06:20

13 494 0
Tài liệu Báo cáo khoa học: Regulation of connective tissue growth factor (CTGF/CCN2) gene transcription and mRNA stability in smooth muscle cells Involvement of RhoA GTPase and p38 MAP kinase and sensitivity to actin dynamics docx

Tài liệu Báo cáo khoa học: Regulation of connective tissue growth factor (CTGF/CCN2) gene transcription and mRNA stability in smooth muscle cells Involvement of RhoA GTPase and p38 MAP kinase and sensitivity to actin dynamics docx

... Sugawara, A. , Mukoyama,M.,Mori,K.,Makino,H., Suganami, T., Nagae, T ., Yahata , K ., Fujinaga, Y., Tanaka, I . & Nakao, K. (2001) Role of connect ive tissue growth factor in profibrotic action ... Kawahara, T., Morishita, T. , Tamakawa, H., Yamagami, K., Inui, J., Maekawa, M. & Narumiya, S. (1997) Calcium sensitization of sm ooth musc le mediated by a Rho-associated protein...

Ngày tải lên: 19/02/2014, 16:20

15 576 0
Tài liệu Báo cáo khoa học: Effect of deletion of the DNase I hypersensitive sites on the transcription of chicken Ig-b gene and on the maintenance of active chromatin state in the Ig-b locus docx

Tài liệu Báo cáo khoa học: Effect of deletion of the DNase I hypersensitive sites on the transcription of chicken Ig-b gene and on the maintenance of active chromatin state in the Ig-b locus docx

... 9210 and image quant (Amersham Bioscienc- es, Piscataway, NJ, USA). Acetylation status of H3 and H4 histones was examined by chromatin immunoprecipitation (ChIP) and real-time PCR (R-PCR) as described ... pro- moters and enhancers but also are likely to participate in the establishment and maintenance of an active chromatin state [18,28,29]. In addition to their pres- ence in and adjace...

Ngày tải lên: 19/02/2014, 16:20

11 639 0
Tài liệu Báo cáo khoa học: Characterization of the promoter for the mouse a3 integrin gene Involvement of the Ets-family of transcription factors in the promoter activity doc

Tài liệu Báo cáo khoa học: Characterization of the promoter for the mouse a3 integrin gene Involvement of the Ets-family of transcription factors in the promoter activity doc

... 5¢- ATGGTACCTGGTGATCCAGGGCTTGC-3¢ Sac 5¢- CCGTTCCGAGCTCCGAGCAC-3¢ S3 5¢- ATGAGCTCGGGAACCCTTAAAGCCCG-3¢ S2 5¢- ATGAGCTCTGCTTTCCTTCCGGGGA-3¢ S1 5¢- ATTGAGCTCACCAGGAGGGCAGGAGG-3¢ mEts-R* 5¢-GACACCTGTCGGTAACCCTTAAAGCC-3¢ mGATA* ... experiments. Mutated bases are underlined. Primer Sequence K4 5¢- GTGGTACCAGTAGCAGCCGCCGCAAG-3¢ K3 5¢- ATGGTACCGGGCTTTAAGGGTTCCCG-3¢ K2 5¢- ATGGTACCGGAAGGAAAGCAGAGCCC-...

Ngày tải lên: 21/02/2014, 03:20

9 562 0
w