Tài liệu Báo cáo khoa học: A novel type of highly negatively charged lipooligosaccharide from Pseudomonas stutzeri OX1 possessing two 4,6-O-(1-carboxy)-ethylidene residues in the outer core region ppt

... Thomas-Oates, J.E. & Brade, H. (1994) Preparation and structural analysis of oligosaccharide monophosphates obtained from the lipopolysaccharide of recombinant strains of Salmonella minnesota ... conclusion, the data above allowed the identification of the carbohydrate backbone from alkaline degradation of the rough form LPS from P. stutzeri OX1. Isolation, NM...

Ngày tải lên: 19/02/2014, 13:20

... the synthesis of thermozeaxanthins and thermobiszeaxanthins, which are the main carotenoids of T. thermophilus [15]. The insertion of thermozeax- anthins and thermobiszeaxanthins into the cell ... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAY...

Ngày tải lên: 18/02/2014, 08:20

... distance of about 14 A ˚ between the C2 of nicotinamide and the C6 of the adenine ring. As indicated in the superpositions of Figs 2 and 3, the main difference is the displacement of Ala88 and ... is a result of cosubstrate binding and that it is not a result of crys- tal packing interactions. The nature of the conforma- tional change could be character...

Ngày tải lên: 18/02/2014, 16:20

... 5¢-AAGTAGGCGGAGTATCGAAC-3¢ (sense) and 5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primers for unmethylated DNA were: 5¢-GAAGTAGGTGGAGT ATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCT ACTT-3¢ (antisense). Caspase 3 activity Cells ... Relative fluorescence intensity was determined using imagemaster 2d elite software 4.01 (Amersham Bioscience, Uppsala, Sweden). Statistical analysis Data in bar graphs...

Ngày tải lên: 18/02/2014, 18:20

... evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide Atsuhiro Kanda, Kyoko Takuwa-Kuroda, Masato Aoyama and Honoo Satake Suntory Institute for Bioorganic Research, Osaka, Japan Tachykinins ... 8, 459–467. 10 Kanda A, Iwakoshi-Ukena E, Takuwa-Kuroda K & Minakata H (2003) Isolation and characterization of novel tachykinins from the posterior salivary gla...

Ngày tải lên: 19/02/2014, 00:20

... NADPH were also obtained from Sigma. Sephadex G-25 was pur- chased from Pharmacia (Uppsala, Sweden). All the other materials were of analytical grade and obtained from Beijing Chemical Plant (Beijing, ... First, the substrate-binding site should match the size and shape of the substrates, and second, incorporation of an imido-group increases the stability of transition...

Ngày tải lên: 19/02/2014, 02:20

... [6,8,27] or to any other sequences available in FASTA and BLAST database programs at the DNA Data Bank of Jap an. Recently, we reported the cloning and s equencing of the gene encoding 4-amino-3-hydroxybenzoate ... and 2-aminomuconic acid in the modified meta-cleavage path- way (Fig. 1B). The 2-aminomuconate deaminase from s train AP-3 and that from strain JS45 have been...

Ngày tải lên: 19/02/2014, 16:20

... to clone the MABO gene. The DNA fragment carrying the MABO ORF was amplified with the primer pair 5¢-GAC CTGAGTAGAAATGGATCCCTGA TGGACAGG-3¢ and 5¢-GGAATGGCTCGAGGGATCATCACC-3¢ bear- ing the restriction ... role in the biodegradation of a n a lmost unlimited spectrum of natural and man-made organic compounds, among them the tobacco alkaloid nicotine. Perhaps analysed in...

Ngày tải lên: 19/02/2014, 16:20

... both internal and external context. Internal context includes the characters inside two entities and the characters inside the heads of two entities. External context involves the characters around ... and then subtypes under a certain type) . However, these two strategies lack of interaction between the two classification levels. To insure consistency in an...

Ngày tải lên: 20/02/2014, 09:20

... VI) showed a linear rate up to 30 min (Fig. 4A) . After further incubation it deviated from the linearity and became saturated at  60 min. Titration of helicase activity with increasing amounts of the ... kinase and DNA polymerase I were from New England Biolabs; trypsin was from Serva (Heidel- berg, Germany); the DNA-intercalating compounds dau- norubicin, camptothecin, VP...

Ngày tải lên: 20/02/2014, 11:20