Tài liệu Báo cáo khoa học: A tyrosinase with an abnormally high tyrosine hydroxylase/dopa oxidase ratio Role of the seventh histidine and accessibility to the active site docx

Tài liệu Báo cáo khoa học: A tyrosinase with an abnormally high tyrosine hydroxylase/dopa oxidase ratio Role of the seventh histidine and accessibility to the active site docx

Tài liệu Báo cáo khoa học: A tyrosinase with an abnormally high tyrosine hydroxylase/dopa oxidase ratio Role of the seventh histidine and accessibility to the active site docx

... Journal 273 (2006) 257–270 ª 2005 FEBS 261 A tyrosinase with an abnormally high tyrosine hydroxylase/dopa oxidase ratio Role of the seventh histidine and accessibility to the active site Diana Herna ´ ndez-Romero 1 , ... repor- ted the existence and expression of a multipotent lac- case and a tyrosinase in Marinomonas mediterranea [11,13...

Ngày tải lên: 19/02/2014, 07:20

14 849 0
Tài liệu Báo cáo khoa học: A second novel dye-linked L-proline dehydrogenase complex is present in the hyperthermophilic archaeon Pyrococcus horikoshii OT-3 pptx

Tài liệu Báo cáo khoa học: A second novel dye-linked L-proline dehydrogenase complex is present in the hyperthermophilic archaeon Pyrococcus horikoshii OT-3 pptx

... prepared to construct the expression plasmid for the PDH1 gene: 5¢-AGGGATGCATATGAGACCT CTAGATCTAAC-3¢ and 5¢-AGGCCCCGGGTCACCTC CTAGCTAGAATTC-3¢ for a1 ; and 5¢-AGGTGATC ATATGCTTCTAGAGAAGAGTGAAATA-3¢ ... pET1 1a was digested with NdeI and BamHI. The a1 and b 1 gene fragments were introduced into pET1 1a after linearizing it with NdeI and blunted- BamHI to generate p...

Ngày tải lên: 20/02/2014, 01:20

11 550 0
Tài liệu Báo cáo khoa học: A DExD⁄ H box RNA helicase is important for K+ deprivation responses and tolerance in Arabidopsis thaliana docx

Tài liệu Báo cáo khoa học: A DExD⁄ H box RNA helicase is important for K+ deprivation responses and tolerance in Arabidopsis thaliana docx

... for the functional analysis of plant DEVH box RNA helicases, and suggest that AtHELPS, as an impor- tant negative regulator, plays a role in K + deprivation stress. Abbreviations ABA, abscisic acid; ... of K + that help support plant growth and survival. To ensure an adequate supply of K + , plants have a num- ber of redundant mechanisms for K + acquisition and tra...

Ngày tải lên: 14/02/2014, 18:20

11 786 0
Tài liệu Báo cáo khoa học: a-enolase: a promising therapeutic and diagnostic tumor target ppt

Tài liệu Báo cáo khoa học: a-enolase: a promising therapeutic and diagnostic tumor target ppt

... de-differentiation and correlated positively with venous invasion [93,94]. In breast and lung cancer patients, anti-ENOA autoantibodies are decreased in the advanced stages of the disease [69]. In pancreatic ... [63]. Activation of the immune system against TAAs occurs at an early stage of tumorigenesis, as illustrated by the detection of high titers of autoantibod...

Ngày tải lên: 14/02/2014, 19:20

11 722 0
Tài liệu Báo cáo khoa học: A systems biology approach for the analysis of carbohydrate dynamics during acclimation to low temperature in Arabidopsis thaliana doc

Tài liệu Báo cáo khoa học: A systems biology approach for the analysis of carbohydrate dynamics during acclimation to low temperature in Arabidopsis thaliana doc

... abundance, metabolite concentration and other biological parameters with an iterative model, and exploration of model characteristics such as modular- ity, optimality and robustness, promise to advance ... distribution of plants. During the so-called process of cold acclimation, many plants are able to develop low-temperature tolerance, associated with the reprogramm...

Ngày tải lên: 14/02/2014, 22:20

13 708 0
Tài liệu Báo cáo khoa học: A strategy for discovery of cancer glyco-biomarkers in serum using newly developed technologies for glycoproteomics ppt

Tài liệu Báo cáo khoa học: A strategy for discovery of cancer glyco-biomarkers in serum using newly developed technologies for glycoproteomics ppt

... microarray approach to analysis of the dynamic mammalian glycome. Proc Natl Acad Sci USA 104, 11534–11539. 14 Tateno H, Uchiyama N, Kuno A, Togayachi A, Sato T, Narimatsu H & Hirabayashi ... 4725–4733. 22 Kagebayashi C, Yamaguchi I, Akinaga A, Kitano H, Yokoyama K, Satomura M, Kurosawa T, Watanabe M, Kawabata T, Chang W et al. (2009) Automated immunoassay system for AFP-L3% using...

Ngày tải lên: 16/02/2014, 08:20

11 854 0
Tài liệu Báo cáo khoa học: a-Defensins increase lung fibroblast proliferation and collagen synthesis via the b-catenin signaling pathway doc

Tài liệu Báo cáo khoa học: a-Defensins increase lung fibroblast proliferation and collagen synthesis via the b-catenin signaling pathway doc

... for the mRNA of b-catenin were 5¢-AAAGCTGATATTGATGGACAG-3¢. The siRNA against luciferase mRNA was used as a control siRNA. The target sequence for luciferase mRNA was 5¢-AACG TACGCGGAATACTTCGA-3¢. ... with alpha(1)-antitrypsin deficiency and moderate to severe lung disease. Cytokine 32, 1–6. 6 Ashitani J, Mukae H, Arimura Y, Sano A, Tokojima M & Nakazato M (2004) High co...

Ngày tải lên: 18/02/2014, 06:20

12 602 0
Tài liệu Báo cáo khoa học: A role of miR-27 in the regulation of adipogenesis ppt

Tài liệu Báo cáo khoa học: A role of miR-27 in the regulation of adipogenesis ppt

... were treated as described in (A) . Total RNA was prepared at the indicated times and subjected to quantitative real-time PCR analysis. The data shown are mean value ± standard errors of the mean from ... (Santa Cruz Biotechnology, Santa Cruz, CA, USA), and anti-PPARa (Zymed Laboratories, South San Francisco, CA, USA), and mouse monoclonal anti-b-actin (Sigma Aldrich, St Louis,...

Ngày tải lên: 18/02/2014, 08:20

11 849 0
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... of the FNR (Fig. 5A) . The Fdx ⁄ CYP17 5A1 ratio was saturated at 8 : 1, and the turnover rate at an Fdx ⁄ CYP17 5A1 ratio of 8 : 1 was 4.9-fold greater than that at a ratio of 1 : 1 (Fig. 5B). The ... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFR...

Ngày tải lên: 18/02/2014, 08:20

14 617 0
w