Tài liệu Báo cáo khoa học: A tyrosinase with an abnormally high tyrosine hydroxylase/dopa oxidase ratio Role of the seventh histidine and accessibility to the active site docx
Tài liệu Báo cáo khoa học: A tyrosinase with an abnormally high tyrosine hydroxylase/dopa oxidase ratio Role of the seventh histidine and accessibility to the active site docx
... Journal 273 (2006) 257–270 ª 2005 FEBS 261 A tyrosinase with an abnormally high tyrosine hydroxylase/dopa oxidase ratio Role of the seventh histidine and accessibility to the active site Diana Herna´ndez-Romero1, ... repor-ted the existence and expression of a multipotent lac-case and a tyrosinase in Marinomonas mediterranea[11,13].We have now found in R. solanacearum that the two tyrosinase- like genes and the ... 2-mercaptoethanol and 9% SDS) and heated at 95 °C for 5 min before application.Electrophoresis was run at 20 °C and a constant current of 15 mA for 20 min and 30 mA for 90 min. Protein bandswere...
- 14
- 849
- 0
Tài liệu Báo cáo khoa học: A second novel dye-linked L-proline dehydrogenase complex is present in the hyperthermophilic archaeon Pyrococcus horikoshii OT-3 pptx
... prepared to construct the expression plasmidfor the PDH1 gene: 5¢-AGGGATGCATATGAGACCTCTAGATCTAAC-3¢ and 5¢-AGGCCCCGGGTCACCTCCTAGCTAGAATTC-3¢ for a1 ; and 5¢-AGGTGATCATATGCTTCTAGAGAAGAGTGAAATA-3¢ ... pET1 1a was digested with NdeI and BamHI. The a1 and b 1 gene fragments were introducedinto pET1 1a after linearizing it with NdeI and blunted-BamHI to generate pET1 1a ⁄ a1 and with NdeI and BamHI to ... and additionalammonium sulfate was added to the resultant supernatantcontaining the enzyme to bring it up to 70% saturation.Then after 1 h the solution was centrifuged, and the pre-cipitant,...
- 11
- 549
- 0
Tài liệu Báo cáo khoa học: A DExD⁄ H box RNA helicase is important for K+ deprivation responses and tolerance in Arabidopsis thaliana docx
... for the functional analysis of plant DEVH box RNA helicases, and suggest that AtHELPS, as an impor-tant negative regulator, plays a role in K+deprivation stress.AbbreviationsABA, abscisic acid; ... of K+that help support plant growth and survival. To ensure an adequate supply of K+, plants have a num-ber of redundant mechanisms for K+acquisition and translocation [5–7]. In the past decade, ... was assigned a value of 1. Data represent the average of three independent experiments ± standard devia-tion. Standard errors are shown as bars above the columns.R R. Xu et al. Analysis of an...
- 11
- 786
- 0
Tài liệu Báo cáo khoa học: a-enolase: a promising therapeutic and diagnostic tumor target ppt
... de-differentiation and correlated positively with venous invasion [93,94].In breast and lung cancer patients, anti-ENOAautoantibodies are decreased in the advanced stages of the disease [69]. In pancreatic ... [63].Activation of the immune system against TAAs occursat an early stage of tumorigenesis, as illustrated by the detection of high titers of autoantibodies in patients with early-stage cancer [64], and ... pancreaticcancer and normal pancreas, and one of them is the only acetylated residue in cervix tumor. Three acetyla-tions are common to both leukemia and pancreaticcancer, whereas three are specific...
- 11
- 721
- 0
Tài liệu Báo cáo khoa học: A systems biology approach for the analysis of carbohydrate dynamics during acclimation to low temperature in Arabidopsis thaliana doc
... abundance, metabolite concentration and otherbiological parameters with an iterative model, and exploration of model characteristics such as modular-ity, optimality and robustness, promise to advance ... distribution of plants. During the so-called process of coldacclimation, many plants are able to develop low-temperature tolerance,associated with the reprogramming of a large part of their metabolism. ... exposure, and became significantly higherthan in C24 after 7 days at 4 °C. As compared with that of vInv, the activities of nInv and eInv were low, and became noticeably higher only in Rsch after7 days...
- 13
- 707
- 0
Tài liệu Báo cáo khoa học: A strategy for discovery of cancer glyco-biomarkers in serum using newly developed technologies for glycoproteomics ppt
... microarray approach to analysis of the dynamic mammalian glycome. Proc Natl Acad Sci USA104, 11534–11539.14 Tateno H, Uchiyama N, Kuno A, Togayachi A, SatoT, Narimatsu H & Hirabayashi ... 4725–4733.22 Kagebayashi C, Yamaguchi I, Akinaga A, Kitano H,Yokoyama K, Satomura M, Kurosawa T, WatanabeM, Kawabata T, Chang W et al. (2009) Automatedimmunoassay system for AFP-L3% using ... functionalanalysis of glycosylation associated with diseases.Armed with our knowledge of human glycosylation,glycan structural analysis systems, the bioinformaticscapability and the databases that...
- 11
- 854
- 0
Tài liệu Báo cáo khoa học: a-Defensins increase lung fibroblast proliferation and collagen synthesis via the b-catenin signaling pathway doc
... for the mRNA of b-cateninwere 5¢-AAAGCTGATATTGATGGACAG-3¢. The siRNAagainst luciferase mRNA was used as a control siRNA. The target sequence for luciferase mRNA was 5¢-AACGTACGCGGAATACTTCGA-3¢. ... with alpha(1)-antitrypsin deficiency and moderate to severelung disease. Cytokine 32, 1–6.6 Ashitani J, Mukae H, Arimura Y, Sano A, TokojimaM & Nakazato M (2004) High concentrations of alpha-defensins ... Medical ResearchInstitute grants 032040 and 072104, and AmericanHeart Association Greater Southeast Affiliate grants0555322B and 0855338E.References1 Aarbiou J, Rabe KF & Hiemstra PS...
- 12
- 602
- 0
Tài liệu Báo cáo khoa học: A role of miR-27 in the regulation of adipogenesis ppt
... were treated as described in (A) . Total RNA wasprepared at the indicated times and subjected to quantitative real-time PCR analysis. The data shown are mean value ± standard errors of the mean from ... (Santa Cruz Biotechnology, Santa Cruz, CA,USA), and anti-PPARa (Zymed Laboratories, South SanFrancisco, CA, USA), and mouse monoclonal anti-b-actin(Sigma Aldrich, St Louis, MO, USA).Quantitative ... epididymal fat pads harvested from ob ⁄ obmice and genetically matched lean mice. Levels of miRNA expres-sion were analyzed by TaqMan quantitative PCR. Data are meanvalue ± standard errors of the...
- 11
- 848
- 0
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc
... of the FNR (Fig. 5A) . The Fdx ⁄ CYP17 5A1 ratio was saturated at 8 : 1, and the turnover rate at an Fdx ⁄ CYP17 5A1 ratio of 8 : 1 was4.9-fold greater than that at a ratio of 1 : 1 (Fig. 5B). The ... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... Escherichia coli and purified to homogeneity. The purified recombinantFNR and Fdx had the same chromatographic, photo-metric and catalytic properties as the native FNR and Fdx (data not shown). Although...
- 14
- 617
- 0
Từ khóa: tài liệu báo cáo khoa học bản chất của khủng hoảng kinh tế thế giới pdftài liệu báo cáo nghiên cứu khoa họctài liệu về báo cáo khoa họcbáo cáo khoa học tài chính côngbáo cáo khoa học số loài quý hiếm tại vườn quốc gia ba bểtai lieu bao cao thuc tap khoa co khiBáo cáo quy trình mua hàng CT CP Công Nghệ NPVNghiên cứu tổ chức pha chế, đánh giá chất lượng thuốc tiêm truyền trong điều kiện dã ngoạiNghiên cứu tổ chức chạy tàu hàng cố định theo thời gian trên đường sắt việt namđề thi thử THPTQG 2019 toán THPT chuyên thái bình lần 2 có lời giảiBiện pháp quản lý hoạt động dạy hát xoan trong trường trung học cơ sở huyện lâm thao, phú thọĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANQuản lý hoạt động học tập của học sinh theo hướng phát triển kỹ năng học tập hợp tác tại các trường phổ thông dân tộc bán trú huyện ba chẽ, tỉnh quảng ninhPhối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọPhát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninhPhát hiện xâm nhập dựa trên thuật toán k meansNghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúngTìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tinSở hữu ruộng đất và kinh tế nông nghiệp châu ôn (lạng sơn) nửa đầu thế kỷ XIXBT Tieng anh 6 UNIT 2Tranh tụng tại phiên tòa hình sự sơ thẩm theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn xét xử của các Tòa án quân sự Quân khu (Luận văn thạc sĩ)chuong 1 tong quan quan tri rui roGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtĐổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt namTÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲ