Tài liệu Báo cáo khoa học: A tyrosinase with an abnormally high tyrosine hydroxylase/dopa oxidase ratio Role of the seventh histidine and accessibility to the active site docx

... Journal 273 (2006) 257–270 ª 2005 FEBS 261 A tyrosinase with an abnormally high tyrosine hydroxylase/dopa oxidase ratio Role of the seventh histidine and accessibility to the active site Diana Herna ´ ndez-Romero 1 , ... repor- ted the existence and expression of a multipotent lac- case and a tyrosinase in Marinomonas mediterranea [11,13...

Ngày tải lên: 19/02/2014, 07:20

... prepared to construct the expression plasmid for the PDH1 gene: 5¢-AGGGATGCATATGAGACCT CTAGATCTAAC-3¢ and 5¢-AGGCCCCGGGTCACCTC CTAGCTAGAATTC-3¢ for a1 ; and 5¢-AGGTGATC ATATGCTTCTAGAGAAGAGTGAAATA-3¢ ... pET1 1a was digested with NdeI and BamHI. The a1 and b 1 gene fragments were introduced into pET1 1a after linearizing it with NdeI and blunted- BamHI to generate p...

Ngày tải lên: 20/02/2014, 01:20

...

Ngày tải lên: 20/02/2014, 18:20

... for the functional analysis of plant DEVH box RNA helicases, and suggest that AtHELPS, as an impor- tant negative regulator, plays a role in K + deprivation stress. Abbreviations ABA, abscisic acid; ... of K + that help support plant growth and survival. To ensure an adequate supply of K + , plants have a num- ber of redundant mechanisms for K + acquisition and tra...

Ngày tải lên: 14/02/2014, 18:20

... de-differentiation and correlated positively with venous invasion [93,94]. In breast and lung cancer patients, anti-ENOA autoantibodies are decreased in the advanced stages of the disease [69]. In pancreatic ... [63]. Activation of the immune system against TAAs occurs at an early stage of tumorigenesis, as illustrated by the detection of high titers of autoantibod...

Ngày tải lên: 14/02/2014, 19:20

... abundance, metabolite concentration and other biological parameters with an iterative model, and exploration of model characteristics such as modular- ity, optimality and robustness, promise to advance ... distribution of plants. During the so-called process of cold acclimation, many plants are able to develop low-temperature tolerance, associated with the reprogramm...

Ngày tải lên: 14/02/2014, 22:20

... microarray approach to analysis of the dynamic mammalian glycome. Proc Natl Acad Sci USA 104, 11534–11539. 14 Tateno H, Uchiyama N, Kuno A, Togayachi A, Sato T, Narimatsu H & Hirabayashi ... 4725–4733. 22 Kagebayashi C, Yamaguchi I, Akinaga A, Kitano H, Yokoyama K, Satomura M, Kurosawa T, Watanabe M, Kawabata T, Chang W et al. (2009) Automated immunoassay system for AFP-L3% using...

Ngày tải lên: 16/02/2014, 08:20

... for the mRNA of b-catenin were 5¢-AAAGCTGATATTGATGGACAG-3¢. The siRNA against luciferase mRNA was used as a control siRNA. The target sequence for luciferase mRNA was 5¢-AACG TACGCGGAATACTTCGA-3¢. ... with alpha(1)-antitrypsin deficiency and moderate to severe lung disease. Cytokine 32, 1–6. 6 Ashitani J, Mukae H, Arimura Y, Sano A, Tokojima M & Nakazato M (2004) High co...

Ngày tải lên: 18/02/2014, 06:20

... were treated as described in (A) . Total RNA was prepared at the indicated times and subjected to quantitative real-time PCR analysis. The data shown are mean value ± standard errors of the mean from ... (Santa Cruz Biotechnology, Santa Cruz, CA, USA), and anti-PPARa (Zymed Laboratories, South San Francisco, CA, USA), and mouse monoclonal anti-b-actin (Sigma Aldrich, St Louis,...

Ngày tải lên: 18/02/2014, 08:20

... of the FNR (Fig. 5A) . The Fdx ⁄ CYP17 5A1 ratio was saturated at 8 : 1, and the turnover rate at an Fdx ⁄ CYP17 5A1 ratio of 8 : 1 was 4.9-fold greater than that at a ratio of 1 : 1 (Fig. 5B). The ... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFR...

Ngày tải lên: 18/02/2014, 08:20