Tài liệu Báo cáo khoa học: Fish and molluscan metallothioneins A structural and functional comparison ppt

... AM, Columbaro M, Scarano G, Mattioli E, Sabatelli P, et al. (2005) Alterations of nuclear envel- ope and chromatin organization in mandibuloacral dys- plasia, a rare form of laminopathy. Physiol ... forms in mammals, designated A- type (lamin A and lamin C) and B-type (lamin B1 and lamin B2), in addition to an increasing number of associated proteins [4]. Lamins were originally i...

Ngày tải lên: 19/02/2014, 02:20

... The Authors. Journal compilation ª 2005 FEBS 6023 Fish and molluscan metallothioneins A structural and functional comparison Laura Vergani 1 , Myriam Grattarola 1 , Cristina Borghi 2 , Francesco ... we added a BamHI site upstream from the ATG codon, using the 5¢-end primer (5¢-CTACTACGAATTAGGATCCCCT GCACCTTG-3¢) and the 3¢-end primer (5¢-GTAATACGA CTCACTATAGGGCGAATTGGG-3...

Ngày tải lên: 19/02/2014, 07:20

... xylanase mutants with a modified secondary binding site to water-unextractable arabinoxylan (WU-AX) (A) and oat spelt xylan (OSX) (B) and of A. niger xylanase mutants to water-unextractable arabinoxylan ... X 6 is a soluble, linear, oligomeric substrate. Xylazyme AX and Azo-wheat AX are polymeric chromo- phoric AX that are water-unextractable and water- extractable, respectively....

Ngày tải lên: 14/02/2014, 19:20

... iweber@gsu.edu *Present address Bioscience Division, MS M888, Los Alamos National Laboratory, Los Alamos, NM, USA Database The atomic coordinates and structure factors are available in the Protein Data Bank with accession ... side chains of Asp30 and Asp30¢ accommodate diverse functional groups at P2 and P2¢ of SQV and APV at the surface of the PR active site cavity. The functional...

Ngày tải lên: 18/02/2014, 04:20

... infection, as assessed by the mitochondrial release of cytochrome c, caspase-9 and caspase-3 activa- tion, and DNA fragmentation. In an in vitro assay, intact ETA induced ADP-ribosylation of EF-2 and ... (h) AEEAFDLWNECAKACVLDLKDGVRSSRMSVDPAIADTNGQGVLHYSMVLEGGNDALKLAIDN ALSITSDGLTIRLEGGVEPNKPVRYSYTRQARGSWSLNWLVPIGHEKPSNIKVFIHELNAGN QLSHMSPIYTIEMGDELLAKLARDATFFVRAHESNEMQPTLAISHAGVSVVMAQT...

Ngày tải lên: 18/02/2014, 04:20

... one a- helix, a helical turn and seven b-strands that form an N-terminal hairpin and an anti-parallel b-sheet, with a characteris- tic a + b fold and a highly positive charged surface. Compared ... del Pozo A & Gavilanes JG (2001) RNase U2 and alpha- sarcin: a study of relationships. Meth Enzymol 341, 335–351. 3 Lacadena J, A ´ lvarez-Garcı ´ a E, Carreras-Sangra...

Ngày tải lên: 18/02/2014, 08:20

... NV (2001) Acute hypoxia and hypoxic exercise induce DNA strand breaks and oxidative DNA damage in humans. FASEB J 15, 1181–1186. 33 Speit G & Hartmann A (2006) The comet assay: a sensi- tive ... antioxidant and redox potential regulator that plays a vital role in drug detoxification and in cellular protection against damage by free radicals, peroxides, and toxins [13]. Hypo...

Ngày tải lên: 18/02/2014, 16:20

... benzo [a] pyrene-2¢-deoxyguanosine adducts affects DNA methylation by SssI and HhaI DNA methyltransferases Oksana M. Subach 1 , Diana V. Maltseva 1 , Anant Shastry 2 , Alexander Kolbanovskiy 2 , Saulius Klimas ˇ auskas 3 , ... Wyszynski MW, Gabbara S, Kubareva EA, Romanova EA, Oretskaya TS, Gromova ES, Shabarova ZA & Bhagwat AS (1993) The cysteine conserved among DNA cytosine methylases...

Ngày tải lên: 19/02/2014, 00:20

... Restriction enzymes and T4 ligase were purchased from New England Biolabs (Ipswich, MA, USA). Pfu DNA polymerase and the pET-17b vector were purchased from Stratagene (La Jolla, CA, USA) and Novagen (Madison, ... intermediate as that of the aldolase reaction and that SaDHNA and EcDHNA have significantly different equilibrium and kinetic constants, which form the basis for elucidati...

Ngày tải lên: 19/02/2014, 00:20

... same high-affinity behavior for choline analogs and become saturated at 2mm (Fig. 2A) , and agrees with the higher apparent affinity of ipratropium and atropine than of choline for C-LytA (Table 1, ... of C-LytA at 20 °C and pH 7.0, showing two maxima at 265 nm and 290 nm. Upon addition of 20 mm choline (a saturating concentration of ligand), two minima at 284 nm and 294 nm appear...

Ngày tải lên: 19/02/2014, 05:20