Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt

... CumOOH, and NADPH were also obtained from Sigma. Sephadex G-25 was pur- chased from Pharmacia (Uppsala, Sweden). All the other materials were of analytical grade and obtained from Beijing Chemical ... experi- ment carried out without the mimic, ascorbate, and ferrous sulfate was known as the control group. Biological analysis of mimics against mitochondrial damage Mitochondrial swelling was a...

Ngày tải lên: 19/02/2014, 02:20

... cross-react with antibodies against plant helicases including PDH45 and PDH65 and also against human DNA helicases I, II, III and IV (data not shown). ssDNA-dependent ATPase activity was present at a ... the graph). The DNA helicase activity (Fig. 2A, lane 4) and ssDNA-dependent ATPase activity (data not shown) sedimented together between alcohol dehydrogenase and BSA (fraction 11)...

Ngày tải lên: 20/02/2014, 11:20

... 277 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... DNA poly- merase was purchased from Toyobo (Osaka, Japan). Emul- gen 911 was a gift from Kao Chemical (Tokyo, Japan). NADPH, NADH and NADP + were purchased from Oriental Yeast (Tokyo...

Ngày tải lên: 18/02/2014, 08:20

... (sense) and 5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primers for unmethylated DNA were: 5¢-GAAGTAGGTGGAGT ATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCT ACTT-3¢ (antisense). Caspase 3 activity Cells ... caspase assay were seeded on a 24-well plate and transfected with FuGENE 6. The caspase assay was performed using the CaspACE colorimetric assay kit as described by the manufacturer (Promega...

Ngày tải lên: 18/02/2014, 18:20

... vulgaris). Biochem J 387, 85–91. 25 Kanda A, Takahashi T, Satake H & Minakata H (2006) Molecular and functional characterization of a novel gonadotropin-releasing-hormone receptor isolated ... 8, 459–467. 10 Kanda A, Iwakoshi-Ukena E, Takuwa-Kuroda K & Minakata H (2003) Isolation and characterization of novel tachykinins from the posterior salivary gland of the common octopus...

Ngày tải lên: 19/02/2014, 00:20

... Gram-negative bacteria, and their adaptability to many different pollutants [1]. Pseudomonas stutzeri OX1 is a Gram-negative bacterium isolated from the activated sludge of a wastewater treatment plant, ... Viviana Izzo 2 , Alba Silipo 1 , Luisa Sturiale 3 , Domenico Garozzo 3 , Rosa Lanzetta 1 , Michelangelo Parrilli 1 , Antonio Molinaro 1 and Alberto Di Donato 2 1 Dipartimento di Chimic...

Ngày tải lên: 19/02/2014, 13:20

... (Osaka, Japan); meat extract (Extract Ehlrich) w as from Kyokuto Seiyaku Kogyo (Osaka, Japan); and pentafluorophenylhydrazine was from Pfaltz & Bauer. (Waterbury, CT, USA). DE52 cellulose was from ... only as a carbon source, but also as a nitrogen source for g rowth of the assimilating bacteria. Deaminases, which catalyze the release of ammonia, are a key enzyme in the metabolic pat...

Ngày tải lên: 19/02/2014, 16:20

... man-made organic compounds, among them the tobacco alkaloid nicotine. Perhaps analysed in greatest detail is the pathway of nicotine degradation as it takes place in Arthrobacter nicotinovorans ... c-N-methylamino- butyrate oxidase; megaplasmid pAO1; nicotine degradation; sarcosine o xidase. The bacterial soil community plays a pivotal role in the biodegradation of a n a lmost unlimited...

Ngày tải lên: 19/02/2014, 16:20

... tree-kernel approaches are not suitable for Chinese, at least at current stage. In this paper, we study a feature-based approach that basically integrates entity related information with context ... propose a character-based Chinese entity relation extraction approach that complements entity context (both internal and external) character N-grams with four word lists extracted f...

Ngày tải lên: 20/02/2014, 09:20

... 1 CGACAGgtgagt)3069 bpÀcaacagGTATAT Intron 2 TTTTGTgtaaat)146 bpÀcaacagGTATAA Intron 3 AGACGGgtatga)469 bpÀtttcagGTAGTG Intron 4 TGCCAGgtatgt)119 bpÀttccagATTCCG Fig. 5. Schematic representation ... first-strand cDNA was amplified using the degenerate primers 5¢-AI (A/ C)GIATG (A/ C)GIACIGTIA CIAA(T/C)TA(T/C)TT-3¢ (I represents an inosine residue) and 5¢-CA (A/ G)CA (A/ G)TAIATIGG (A/ G)TT (A/...

Ngày tải lên: 21/02/2014, 03:20