... the biodegradation of a n a lmost unlimited spectrum of natural and man-made organic compounds, among them the tobacco alkaloid nicotine. Perhaps analysed in greatest detail is the pathway of nicotine ... the MABO ORF was amplified with the primer pair 5¢-GAC CTGAGTAGAAATGGATCCCTGA TGGACAGG-3¢ and 5¢-GGAATGGCTCGAGGGATCATCACC-3¢ bear- ing the restriction e nzyme recognition sites...
Ngày tải lên: 19/02/2014, 16:20
... 277 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... Fujiwara and Susumu Imaoka Nanobiotechnology Research Center and Department of Bioscience, School of Science and Technology, Kwansei Gakuin University, Gakuen, Sanda, Japan C...
Ngày tải lên: 18/02/2014, 08:20
Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx
... (sense) and 5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primers for unmethylated DNA were: 5¢-GAAGTAGGTGGAGT ATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCT ACTT-3¢ (antisense). Caspase 3 activity Cells ... intensity was determined using imagemaster 2d elite software 4.01 (Amersham Bioscience, Uppsala, Sweden). Statistical analysis Data in bar graphs are expressed as the mean and standard devia...
Ngày tải lên: 18/02/2014, 18:20
Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt
... tachykinins: a review. Zool Sci 5, 53 3–5 49. 7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy- ama M, Minakata H, Chiba T, Metoki H, Satou Y & Satoh N (2004) Tachykinin and tachykinin receptor of an ascidian, ... (2007) 222 9–2 239 ª 2007 The Authors Journal compilation ª 2007 FEBS 2239 A novel tachykinin- related peptide receptor of Octopus vulgaris –...
Ngày tải lên: 19/02/2014, 00:20
Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt
... glutathione (GSH) (Scheme 1) and protects lipid membranes and other cellular components against oxidative damage [ 1–4 ]. It is related to many diseases and is regarded as one of the most important ... thiobarbituric acid reactive substances (TBARS) as a marker for lipid per- oxidation, and 6-CySeCD, 6-SeCD and Ebselen as antioxidants in ferrous sulfate ⁄ ascorbate-induced mit...
Ngày tải lên: 19/02/2014, 02:20
Tài liệu Báo cáo khoa học: A novel type of highly negatively charged lipooligosaccharide from Pseudomonas stutzeri OX1 possessing two 4,6-O-(1-carboxy)-ethylidene residues in the outer core region ppt
... 64, 362 6–3 632. 7. Arenghi, F.L., Berlanda, D., Galli, E., Sello, G. & Barbieri, P. (2001) Organization and regulation of meta cleavage pathway genes for toluene and o-xylene derivative degradation ... Gram-negative bacteria, and their adaptability to many different pollutants [1]. Pseudomonas stutzeri OX1 is a Gram-negative bacterium isolated from the activated sludge of...
Ngày tải lên: 19/02/2014, 13:20
Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc
... NADPH, and glutamate dehydrogenase were from Wako Pure Chemicals (Osaka, Japan); meat extract (Extract Ehlrich) w as from Kyokuto Seiyaku Kogyo (Osaka, Japan); and pentafluorophenylhydrazine was ... only as a carbon source, but also as a nitrogen source for g rowth of the assimilating bacteria. Deaminases, which catalyze the release of ammonia, are a key enzyme in the metabolic p...
Ngày tải lên: 19/02/2014, 16:20
Tài liệu Báo cáo khoa học: "A Novel Feature-based Approach to Chinese Entity Relation Extraction" ppt
... phrase chunking information and semi-automatically collected country name list and personal relative trigger word list. Jiang and Zhai (2007) then systematically explored a large space of ... reasonable to conclude that kernel-based especially tree-kernel approaches are not suitable for Chinese, at least at current stage. In this paper, we study a feature-based approach tha...
Ngày tải lên: 20/02/2014, 09:20
Tài liệu Báo cáo khoa học: A novel nuclear DNA helicase with high specific activity from Pisum sativum catalytically translocates in the 3¢fi5¢ direction docx
... 2A, lane 4) and ssDNA-dependent ATPase activity (data not shown) sedimented together between alcohol dehydrogenase and BSA (fraction 11) and gave a molecular mass of 120 kDa with a sedimen- tation ... including PDH45 and PDH65 and also against human DNA helicases I, II, III and IV (data not shown). ssDNA-dependent ATPase activity was present at a level of 0.6 · 10 3 pmol...
Ngày tải lên: 20/02/2014, 11:20
Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor docx
... 1 CGACAGgtgagt)3069 bpÀcaacagGTATAT Intron 2 TTTTGTgtaaat)146 bpÀcaacagGTATAA Intron 3 AGACGGgtatga)469 bpÀtttcagGTAGTG Intron 4 TGCCAGgtatgt)119 bpÀttccagATTCCG Fig. 5. Schematic representation ... transmembrane domains and intracellular and extracellular regions displayed high identity to those of mammalian tachykinin receptors and insect tachykinin- related peptide receptors...
Ngày tải lên: 21/02/2014, 03:20