Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx

... of wild-type occludin (Occ WT ) and variant occludin in apoptosis and invasion, as determined by assay, we revealed that exon 9 played a major role in the induc- tion of mitochondria-mediated apoptosis and ... (sense) and 5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primers for unmethylated DNA were: 5¢-GAAGTAGGTGGAGT ATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCT...

Ngày tải lên: 18/02/2014, 18:20

... 277 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... 5A) . The Fdx ⁄ CYP17 5A1 ratio was saturated at 8 : 1, and the turnover rate at an Fdx ⁄ CYP17 5A1 ratio of 8 : 1 was 4 .9- fold greater than that at a ratio of 1 : 1 (Fig. 5B...

Ngày tải lên: 18/02/2014, 08:20

... evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide Atsuhiro Kanda, Kyoko Takuwa-Kuroda, Masato Aoyama and Honoo Satake Suntory Institute for Bioorganic Research, Osaka, Japan Tachykinins ... tachykinins: a review. Zool Sci 5, 533–5 49. 7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy- ama M, Minakata H, Chiba T, Metoki H, Satou Y & Satoh N (2004) Tachy...

Ngày tải lên: 19/02/2014, 00:20

... NADPH were also obtained from Sigma. Sephadex G-25 was pur- chased from Pharmacia (Uppsala, Sweden). All the other materials were of analytical grade and obtained from Beijing Chemical Plant (Beijing, ... selenium- containing GPX mimics. We also studied the catalytic mechanism using steady-state kinetics of 6-CySeCD catalysis and investigated the antioxidant ability of 6-CySeCD usin...

Ngày tải lên: 19/02/2014, 02:20

... the basis of methylation analysis. In agreement with this assignment, a Fig. 5. Negative ion MALDI-TOF mass spectra of oligosaccharide 1 obtained in linear mode at normal (A) and higher laser intensity ... main spin systems were assigned in the NMR spectra, and all chemical data found a rational explanation. The presence of a minor spin system (10%) belonging to rhamnose...

Ngày tải lên: 19/02/2014, 13:20

... [6,8,27] or to any other sequences available in FASTA and BLAST database programs at the DNA Data Bank of Jap an. Recently, we reported the cloning and s equencing of the gene encoding 4-amino-3-hydroxybenzoate ... acid in strain 10d are revealed. Materials and methods Bacterial strain and growth conditions Bordetella sp. strain 10d was isolated previously [10]. Strain 10d w a...

Ngày tải lên: 19/02/2014, 16:20

... to clone the MABO gene. The DNA fragment carrying the MABO ORF was amplified with the primer pair 5¢-GAC CTGAGTAGAAATGGATCCCTGA TGGACAGG-3¢ and 5¢-GGAATGGCTCGAGGGATCATCACC-3¢ bear- ing the restriction ... an indication that binding and positioning of the flavin cofactor a t the active site was not affected. Replace- ment of tryptophan with serine (W66S), also abolished covalent bindin...

Ngày tải lên: 19/02/2014, 16:20

... ORG_AFF.INVESTOR/SHARE, … Table 1 Possible Relations between ARG-1 and ARG-2 Since our classifiers are trained on relations instead of arguments, we simply select the first (as in adjacent and ... least at current stage. In this paper, we study a feature-based approach that basically integrates entity related information with context information. 3.1 Classification Features...

Ngày tải lên: 20/02/2014, 09:20

... cross-react with antibodies against plant helicases including PDH45 and PDH65 and also against human DNA helicases I, II, III and IV (data not shown). ssDNA-dependent ATPase activity was present at a ... EMBO J. 13, 499 1–5001. 16. Tuteja,N.,Phan,T N.,Tuteja,R.,Ochem. ,A. &Falaschi ,A. ( 199 7) Inhibition of DNA unwinding and ATPase activities of human DNA helicase II by ch...

Ngày tải lên: 20/02/2014, 11:20

... DDBJ/EMBL/GenBank databases under accession number AB081457. Intron 1 CGACAGgtgagt)30 69 bpÀcaacagGTATAT Intron 2 TTTTGTgtaaat)146 bpÀcaacagGTATAA Intron 3 AGACGGgtatga)4 69 bpÀtttcagGTAGTG Intron 4 TGCCAGgtatgt)1 19 ... represents an inosine residue) and 5¢-CA (A/ G)CA (A/ G)TAIATIGG (A/ G)TT (A/ G)TA CAT-3¢, corresponding to amino-acid sequences RMRTVTNYF (at transmembrane domain II o...

Ngày tải lên: 21/02/2014, 03:20