Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... Authors Journal compilation ª 2009 FEBS 2429 A novel electron transport system for thermostable CYP17 5A1 from Thermus thermophilus HB27 Takao Mandai, Shinsuke Fujiwa...

Ngày tải lên: 18/02/2014, 08:20

... Gram-negative bacteria, and their adaptability to many different pollutants [1]. Pseudomonas stutzeri OX1 is a Gram-negative bacterium isolated from the activated sludge of a wastewater treatment plant, ... the data above allowed the identification of the carbohydrate backbone from alkaline degradation of the rough form LPS from P. stutzeri OX1. Isolation, NMR and MS analyses of olig...

Ngày tải lên: 19/02/2014, 13:20

... (sense) and 5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primers for unmethylated DNA were: 5¢-GAAGTAGGTGGAGT ATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCT ACTT-3¢ (antisense). Caspase 3 activity Cells ... intensity was determined using imagemaster 2d elite software 4.01 (Amersham Bioscience, Uppsala, Sweden). Statistical analysis Data in bar graphs are expressed as the mean and standard deviation...

Ngày tải lên: 18/02/2014, 18:20

... vulgaris). Biochem J 387, 85–91. 25 Kanda A, Takahashi T, Satake H & Minakata H (2006) Molecular and functional characterization of a novel gonadotropin-releasing-hormone receptor isolated from the ... 8, 459–467. 10 Kanda A, Iwakoshi-Ukena E, Takuwa-Kuroda K & Minakata H (2003) Isolation and characterization of novel tachykinins from the posterior salivary gland of the co...

Ngày tải lên: 19/02/2014, 00:20

... CumOOH, and NADPH were also obtained from Sigma. Sephadex G-25 was pur- chased from Pharmacia (Uppsala, Sweden). All the other materials were of analytical grade and obtained from Beijing Chemical ... thiobarbituric acid reactive substances (TBARS) as a marker for lipid per- oxidation, and 6-CySeCD, 6-SeCD and Ebselen as antioxidants in ferrous sulfate ⁄ ascorbate-induced mito- chon...

Ngày tải lên: 19/02/2014, 02:20

... NADPH, and glutamate dehydrogenase were from Wako Pure Chemicals (Osaka, Japan); meat extract (Extract Ehlrich) w as from Kyokuto Seiyaku Kogyo (Osaka, Japan); and pentafluorophenylhydrazine was ... only as a carbon source, but also as a nitrogen source for g rowth of the assimilating bacteria. Deaminases, which catalyze the release of ammonia, are a key enzyme in the metabolic pat...

Ngày tải lên: 19/02/2014, 16:20

... man-made organic compounds, among them the tobacco alkaloid nicotine. Perhaps analysed in greatest detail is the pathway of nicotine degradation as it takes place in Arthrobacter nicotinovorans ... c-N-methylamino- butyrate oxidase; megaplasmid pAO1; nicotine degradation; sarcosine o xidase. The bacterial soil community plays a pivotal role in the biodegradation of a n a lmost unlimited...

Ngày tải lên: 19/02/2014, 16:20

... approaches are not suitable for Chinese, at least at current stage. In this paper, we study a feature-based approach that basically integrates entity related information with context information. ... nested, adjacent and separated, are used as feature, and a classifier is trained for each relation type and subtype; (2) similar to (1) but all nine structures are concerned; and (...

Ngày tải lên: 20/02/2014, 09:20

... HDH, human DNA helicase; eIF-4 A, eukaryotic translation initiation factor 4A. Property PDH45 a PDH65 b PDH120 Molecular mass: SDS/PAGE 45.5 kDa 65 kDa 54 and 66 kDa Native 45.5 kDa 65 kDa 120 kDa Oligomeric ... substrates (Fig. 5G and H) were prepared as described previously [11,15]. ATP-dependent DNA helicase and DNA-dependent ATPase assays The standard DNA helicase reaction was perform...

Ngày tải lên: 20/02/2014, 11:20

... 1 CGACAGgtgagt)3069 bpÀcaacagGTATAT Intron 2 TTTTGTgtaaat)146 bpÀcaacagGTATAA Intron 3 AGACGGgtatga)469 bpÀtttcagGTAGTG Intron 4 TGCCAGgtatgt)119 bpÀttccagATTCCG Fig. 5. Schematic representation ... reactions (RT-PCRs) and rapid amplifications of cDNA ends were performed using Taq Ex polymerase (Takara, Kyoto, Japan) or rTaq DNA polymerase (Toyobo, Osaka, Japan) and a thermal cycler (model G...

Ngày tải lên: 21/02/2014, 03:20