Tài liệu Báo cáo khoa học: A DExD⁄ H box RNA helicase is important for K+ deprivation responses and tolerance in Arabidopsis thaliana docx

Tài liệu Báo cáo khoa học: A DExD⁄ H box RNA helicase is important for K+ deprivation responses and tolerance in Arabidopsis thaliana docx

Tài liệu Báo cáo khoa học: A DExD⁄ H box RNA helicase is important for K+ deprivation responses and tolerance in Arabidopsis thaliana docx

... 1 was shown to be critical for the bio- genesis of microRNAs and Arabidopsis development [24,25]. Arabidopsis TEBICHI, containing an N-termi- nal DELH box RNA helicase domain and a C-terminal DNA ... Journal 278 (2011) 2296–2306 ª 2011 The Authors Journal compilation ª 2011 FEBS A DExD ⁄ H box RNA helicase is important for K + deprivation responses and...

Ngày tải lên: 14/02/2014, 18:20

11 786 0
Tài liệu Báo cáo khoa học: a-enolase: a promising therapeutic and diagnostic tumor target ppt

Tài liệu Báo cáo khoa học: a-enolase: a promising therapeutic and diagnostic tumor target ppt

... Sahara H, Miyazaki A, Nabeta Y, Hiroh- ashi Y, Kanaseki T, Yamaguchi A, Yamada N, Hiray- ama K, Suzuki M et al. (2002) Natural antigenic peptides from squamous cell carcinoma recognized by autologous ... Lopez- Fernandez LA, Harshman K, Martinez AC, Ortiz AR, Thomson TM & Paciucci R (2007) Activation of the epidermal growth factor signalling pathway by tissue plasminogen activator in...

Ngày tải lên: 14/02/2014, 19:20

11 722 0
Tài liệu Báo cáo khoa học: A systems biology approach for the analysis of carbohydrate dynamics during acclimation to low temperature in Arabidopsis thaliana doc

Tài liệu Báo cáo khoa học: A systems biology approach for the analysis of carbohydrate dynamics during acclimation to low temperature in Arabidopsis thaliana doc

... 2010 The Authors Journal compilation ª 2010 FEBS A systems biology approach for the analysis of carbohydrate dynamics during acclimation to low temperature in Arabidopsis thaliana Thomas Na ¨ gele, ... Hincha DK & Heyer AG (2004) Heterosis in the freezing tolerance of crosses between two Arabidop- sis thaliana accessions (Columbia-0 and C24) that show differences in no...

Ngày tải lên: 14/02/2014, 22:20

13 708 0
Tài liệu Báo cáo khoa học: A strategy for discovery of cancer glyco-biomarkers in serum using newly developed technologies for glycoproteomics ppt

Tài liệu Báo cáo khoa học: A strategy for discovery of cancer glyco-biomarkers in serum using newly developed technologies for glycoproteomics ppt

... 4725–4733. 22 Kagebayashi C, Yamaguchi I, Akinaga A, Kitano H, Yokoyama K, Satomura M, Kurosawa T, Watanabe M, Kawabata T, Chang W et al. (2009) Automated immunoassay system for AFP-L3% using on-chip electrokinetic ... T, Yamauchi Y, Nakayama H, Shinkawa T, Yanagida M, Takahashi N & Isobe T (2002) A direct nanoflow liquid chromatography–tandem mass spectrometry system for interac...

Ngày tải lên: 16/02/2014, 08:20

11 854 0
Tài liệu Báo cáo khoa học: The plasminogen activator inhibitor 2 transcript is destabilized via a multi-component 3¢ UTR localized adenylate and uridylate-rich instability element in an analogous manner to cytokines and oncogenes pdf

Tài liệu Báo cáo khoa học: The plasminogen activator inhibitor 2 transcript is destabilized via a multi-component 3¢ UTR localized adenylate and uridylate-rich instability element in an analogous manner to cytokines and oncogenes pdf

... Forward (nt 1552–1585 PAI-2) SJS260 AACTCACCAT AGGAATGCATAATAAATAACAAAG Reverse (nt 1585–1552 PAI-2) SJS261 CTTTGTTA AAGCTTATGCATTCCTATGGTGAGTT Forward (nt 1552–1585 PAI-2) SJS262 AACTCACCAT AGGAATGCATAAGCTTTAACAAAG ... promoter and total RNA was harvested in Trizol at the indicated times. Total RNA (7.5 lg) from each sample was analysed by RNase protection assay or by northern analys...

Ngày tải lên: 16/02/2014, 09:20

14 636 0
Tài liệu Báo cáo khoa học: a-Defensins increase lung fibroblast proliferation and collagen synthesis via the b-catenin signaling pathway doc

Tài liệu Báo cáo khoa học: a-Defensins increase lung fibroblast proliferation and collagen synthesis via the b-catenin signaling pathway doc

... changes in total b-catenin, suggesting that a- defensins activate the b-catenin signaling pathway. We then studied the role of the b-catenin signaling pathway in a- defensin- induced increases in ... Hiratsuka T, Mukae H, Iiboshi H, Ashitani J, Nabeshima K, Minematsu T, Chino N, Ihi T, Kohno S & Nakazato M (2003) Increased concentrations of human beta-defensins in plasma and...

Ngày tải lên: 18/02/2014, 06:20

12 602 0
Tài liệu Báo cáo khoa học: A role of miR-27 in the regulation of adipogenesis ppt

Tài liệu Báo cáo khoa học: A role of miR-27 in the regulation of adipogenesis ppt

... control was maintained in a standard incubator with 21% O 2 . The normoxia data are the same as shown in Fig. 1 and are included here for comparison. Expression of miR-2 7a and miR-27b at the indicated ... Hosogai N, Fukuhara A, Oshima K, Miyata Y, Tanaka S, Segawa K, Furukawa S, Tochino Y, Komuro R, Matsuda M et al. (2007) Adipose tissue hypoxia in obesity and its impact on...

Ngày tải lên: 18/02/2014, 08:20

11 849 0
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... b-cryptoxanthin [10]. The zeaxanthin produced by CYP17 5A1 is used as an inter- mediate for the synthesis of thermozeaxanthins and thermobiszeaxanthins, which are the main carotenoids of T. thermophilus ... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYS...

Ngày tải lên: 18/02/2014, 08:20

14 617 0
Tài liệu Báo cáo khoa học: A facile method for expression and purification of the Alzheimer’s disease-associated amyloid b-peptide pdf

Tài liệu Báo cáo khoa học: A facile method for expression and purification of the Alzheimer’s disease-associated amyloid b-peptide pdf

... 5¢-ATGGACGCTGAAT TCCGTCACGACTCTGGTTACGAAGTTCACCACCAG AAGCTGGTG-3¢;Abb, 5¢-GTTCACCACCAGAAGCT GGTGTTCTTC GCTGAA GACGT GGGTTCT AACAAG GGTGCT-3¢;Abc, 5¢-CACAACGCCACCAACCATCAGA CCGATGATAGCACCCTTGTTAGAACCCAC-3¢;Ab- start, 5¢-GCGTAGGGTCGACATATGGACGCTGAATT CCGTCACG-3¢;Abstop, ... 5¢-GCGTAGGGTCGACATATGGACGCTGAATT CCGTCACG-3¢;Abstop, 5¢-CCTGCCGAGCTCCTATTA CACAACGCCACCAACCATCAG-3¢. The PCR solution was...

Ngày tải lên: 18/02/2014, 13:20

16 691 0
Tài liệu Báo cáo khoa học: Identification of two late acyltransferase genes responsible for lipid A biosynthesis in Moraxella catarrhalis doc

Tài liệu Báo cáo khoa học: Identification of two late acyltransferase genes responsible for lipid A biosynthesis in Moraxella catarrhalis doc

... on the pulmonary clearance assay, R. Morell for help with DNA sequencing, Yandan Yang for help with Southern blotting, and Lina Zhu and Yili Chen for help in manuscript preparation. This research ... as Neisseria meningitidis and H. in uenzae [13–15]. Studies have also suggested that M. catarrhalis LOS is important in the pathogenesis of M. catarrhalis infection [16–19]....

Ngày tải lên: 18/02/2014, 14:20

14 675 0
w