Tài liệu Báo cáo khoa học: A DExD⁄ H box RNA helicase is important for K+ deprivation responses and tolerance in Arabidopsis thaliana docx

... 1 was shown to be critical for the bio- genesis of microRNAs and Arabidopsis development [24,25]. Arabidopsis TEBICHI, containing an N-termi- nal DELH box RNA helicase domain and a C-terminal DNA ... Journal 278 (2011) 2296–2306 ª 2011 The Authors Journal compilation ª 2011 FEBS A DExD ⁄ H box RNA helicase is important for K + deprivation responses and...

Ngày tải lên: 14/02/2014, 18:20

... Sahara H, Miyazaki A, Nabeta Y, Hiroh- ashi Y, Kanaseki T, Yamaguchi A, Yamada N, Hiray- ama K, Suzuki M et al. (2002) Natural antigenic peptides from squamous cell carcinoma recognized by autologous ... Lopez- Fernandez LA, Harshman K, Martinez AC, Ortiz AR, Thomson TM & Paciucci R (2007) Activation of the epidermal growth factor signalling pathway by tissue plasminogen activator in...

Ngày tải lên: 14/02/2014, 19:20

... 2010 The Authors Journal compilation ª 2010 FEBS A systems biology approach for the analysis of carbohydrate dynamics during acclimation to low temperature in Arabidopsis thaliana Thomas Na ¨ gele, ... Hincha DK & Heyer AG (2004) Heterosis in the freezing tolerance of crosses between two Arabidop- sis thaliana accessions (Columbia-0 and C24) that show differences in no...

Ngày tải lên: 14/02/2014, 22:20

... 4725–4733. 22 Kagebayashi C, Yamaguchi I, Akinaga A, Kitano H, Yokoyama K, Satomura M, Kurosawa T, Watanabe M, Kawabata T, Chang W et al. (2009) Automated immunoassay system for AFP-L3% using on-chip electrokinetic ... T, Yamauchi Y, Nakayama H, Shinkawa T, Yanagida M, Takahashi N & Isobe T (2002) A direct nanoflow liquid chromatography–tandem mass spectrometry system for interac...

Ngày tải lên: 16/02/2014, 08:20

... Forward (nt 1552–1585 PAI-2) SJS260 AACTCACCAT AGGAATGCATAATAAATAACAAAG Reverse (nt 1585–1552 PAI-2) SJS261 CTTTGTTA AAGCTTATGCATTCCTATGGTGAGTT Forward (nt 1552–1585 PAI-2) SJS262 AACTCACCAT AGGAATGCATAAGCTTTAACAAAG ... promoter and total RNA was harvested in Trizol at the indicated times. Total RNA (7.5 lg) from each sample was analysed by RNase protection assay or by northern analys...

Ngày tải lên: 16/02/2014, 09:20

... changes in total b-catenin, suggesting that a- defensins activate the b-catenin signaling pathway. We then studied the role of the b-catenin signaling pathway in a- defensin- induced increases in ... Hiratsuka T, Mukae H, Iiboshi H, Ashitani J, Nabeshima K, Minematsu T, Chino N, Ihi T, Kohno S & Nakazato M (2003) Increased concentrations of human beta-defensins in plasma and...

Ngày tải lên: 18/02/2014, 06:20

... control was maintained in a standard incubator with 21% O 2 . The normoxia data are the same as shown in Fig. 1 and are included here for comparison. Expression of miR-2 7a and miR-27b at the indicated ... Hosogai N, Fukuhara A, Oshima K, Miyata Y, Tanaka S, Segawa K, Furukawa S, Tochino Y, Komuro R, Matsuda M et al. (2007) Adipose tissue hypoxia in obesity and its impact on...

Ngày tải lên: 18/02/2014, 08:20

... b-cryptoxanthin [10]. The zeaxanthin produced by CYP17 5A1 is used as an inter- mediate for the synthesis of thermozeaxanthins and thermobiszeaxanthins, which are the main carotenoids of T. thermophilus ... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYS...

Ngày tải lên: 18/02/2014, 08:20

... 5¢-ATGGACGCTGAAT TCCGTCACGACTCTGGTTACGAAGTTCACCACCAG AAGCTGGTG-3¢;Abb, 5¢-GTTCACCACCAGAAGCT GGTGTTCTTC GCTGAA GACGT GGGTTCT AACAAG GGTGCT-3¢;Abc, 5¢-CACAACGCCACCAACCATCAGA CCGATGATAGCACCCTTGTTAGAACCCAC-3¢;Ab- start, 5¢-GCGTAGGGTCGACATATGGACGCTGAATT CCGTCACG-3¢;Abstop, ... 5¢-GCGTAGGGTCGACATATGGACGCTGAATT CCGTCACG-3¢;Abstop, 5¢-CCTGCCGAGCTCCTATTA CACAACGCCACCAACCATCAG-3¢. The PCR solution was...

Ngày tải lên: 18/02/2014, 13:20

... on the pulmonary clearance assay, R. Morell for help with DNA sequencing, Yandan Yang for help with Southern blotting, and Lina Zhu and Yili Chen for help in manuscript preparation. This research ... as Neisseria meningitidis and H. in uenzae [13–15]. Studies have also suggested that M. catarrhalis LOS is important in the pathogenesis of M. catarrhalis infection [16–19]....

Ngày tải lên: 18/02/2014, 14:20