z l abelian form of two results of f k schmidt

Báo cáo khoa học: "TWO THEORIES FOR COMPUTING THE LOGICAL FORM OF MASS EXPRESSIONS" doc

Báo cáo khoa học: "TWO THEORIES FOR COMPUTING THE LOGICAL FORM OF MASS EXPRESSIONS" doc

... understandings of the lexical nouns For example, the s-theory takes man to be true of individual men and of kinds of men, while the p-theory takes it also to be true of the stuff of which men are ... Conversely, if we have a predicate which is true of individuals and kinds, we shall want to form a predicate true of all the entities that mass predicates are true of qnantities of stuff, kinds of ... objects.) Generally speaking, the theories view the kinds of M as forming an upper semilattice of kinds with M at the top This is a "formal" semilattiee in that the union of any two elements of it is...

Ngày tải lên: 24/03/2014, 01:21

4 309 0
Báo cáo khoa học: " relationships for carbon and nitrogen during early growth of Juglans regia L. seedlings: analysis at two elevated CO concentrations 2" doc

Báo cáo khoa học: " relationships for carbon and nitrogen during early growth of Juglans regia L. seedlings: analysis at two elevated CO concentrations 2" doc

... total N of the plant sample was calculated as follows [11]: with 100-Np coming from Nk corresponding to the seed reserves = proportion of N RESULTS 3.1 Time course of cumulated C in whole seedlings ... oak, where the allocation of 15 originated from a fertilised N soil was not altered by CO [36] In trees, the role of buffer played by the mobilisation of N reserves in case of Despite enrichment, ... whereas alter- ations of C and N accumulation in seedlings began to be noticeable only after complete depletion of seed reserves 4.1 Effect of ] [CO on gas exchanges The first noticeable alterations...

Ngày tải lên: 08/08/2014, 14:21

11 306 0
Báo cáo khoa hoc:" Exclusion of PINK1 as candidate gene for the late-onset form of Parkinson''''s disease in two European populations" pps

Báo cáo khoa hoc:" Exclusion of PINK1 as candidate gene for the late-onset form of Parkinson''''s disease in two European populations" pps

... should include screening of potential promoter as well as enhancer/silencer regions of the gene to finally exclude any lack of influence of PINK1 variation on PD manifestation Yet, functional investigations ... 43:301-304 Strauss KM, Martins LM, Plun-Favreau H, Marx FP, Kautzmann S, Berg D, Gasser T, Wszolek Z, Muller T, Bornemann A, Wolburg H, Downward J, Riess O, Schulz JB, Kruger R: Loss of function mutations ... for lateonset forms of Parkinson's disease, similar to the suggested role of the Parkin gene 0.13 0.0004 * 0.002 * 0.029 * 0.13 0.98 Results All coding exons of the PINK1 gene were screened for...

Ngày tải lên: 11/08/2014, 08:20

4 292 0
WORD FORM OF GRADE 9 FULL .excellent !!!!

WORD FORM OF GRADE 9 FULL .excellent !!!!

... (increase) popular They make every thing faster and more reliable 89.I findthis mgazine (inform) It’s full of rubbish 90.Rading newspapers every day is an effective means of keeping up with the (late) ... there wiil be no foresr left ten years from now 120 The rising level of air pollution has causes concern among (environment) 121 Many factories still allow (pollute), such as toxic waste, to flow ... (nececcitate) like food, rent and fares 150 There have been many (innovate) in the field of electrical engineering 151 No doubt that there will be great (short) of food for the world’s population 152 Television,...

Ngày tải lên: 20/09/2013, 12:10

8 2,5K 130
Tài liệu Form of Word docx

Tài liệu Form of Word docx

... Harmlully/lessly Happily Healthily Historically Lazily Moving/ ed (xuc dong) Naturally Pleasantly Polluted Possessively Practically Reasonably Scientifically Socially Strongly Successfully Variously ... N-ful/ less Careful / Careless: Helpful / helpless Success/ Successful: thcụng N- ful Delight/ delightful: thỳ v (y) Power/ powerful: hựng mnh N- less Cloudless: khụng mõy (khụng) Childless: khụnng ... mong Potentially Preferentially Preferably Really Satisfactorily Solidly Tolerably (kha chac chan) Educationally Decoratively Selectively Sensible painful/lessly additionally Tiem nang Uu tien...

Ngày tải lên: 22/01/2014, 00:20

6 808 13
Tài liệu Supply the correct form of the verbs1 docx

Tài liệu Supply the correct form of the verbs1 docx

... think you ever will.smoked / would have đợi l bạn , l m bừa ^^! Trả l i Trả l i: Bài tập câu điều kiện nè, người l m nha! L m vội, ko bik có sai ko Cats could fly if they (have) had wings If Peter ... wouldn't want to live in a snake 14 My brother managed to kill the snake just at the time when I (be) had been almost exhausted If he (be) had been a little late, I (kill) would have been killed ... live in a snake 14 My brother managed to kill the snake just at the time when I were almost exhausted If he had beena little late, I would have killed by the snake 15 Had I know you were ill,...

Ngày tải lên: 23/01/2014, 07:20

5 1K 3
Tài liệu Báo cáo khoa học: The pro-form of BMP-2 interferes with BMP-2 signalling by competing with BMP-2 for IA receptor binding pptx

Tài liệu Báo cáo khoa học: The pro-form of BMP-2 interferes with BMP-2 signalling by competing with BMP-2 for IA receptor binding pptx

... osteoblast and chondroblast differentiation Mol Biol Cell 10, 3801–3813 The pro form of BMP-2 interferes with BMP-2 signalling 36 Aoki H, Fujii M, Imamura T, Yagi K, Takehara K, Kato M & Miyazono K ... Santa Cruz, CA, USA) at a ratio of lgÆmL)1 cell extract for h at °C Then 25 lL of the solution was added to 25 lL protein A–Sepharose slurry (GE Healthcare) in lysis buffer for h at °C After washing ... pro-domains lead to abnormal dorsoventral patterning [23] and skeletal malformations [24,25] In the case of BMP-2, no published information is available on the physiological function of the pro-domain...

Ngày tải lên: 18/02/2014, 06:20

13 892 0
Tài liệu Báo cáo khoa học: Regulation of dCTP deaminase from Escherichia coli by nonallosteric dTTP binding to an inactive form of the enzyme ppt

Tài liệu Báo cáo khoa học: Regulation of dCTP deaminase from Escherichia coli by nonallosteric dTTP binding to an inactive form of the enzyme ppt

... over mL of mother liquor at room temperature Long (> mm) needle-formed crystals appeared after one week Diffraction data collection Diffraction data were collected on cryo-cooled crystals (100 K) ... E138A:dTTP complex resembles the binding of dTTP to wild-type enzyme, as also expected from the crystallographic analysis of the wild-type:dTTP described Therefore, the lack of activity of H121A and ... dUTPase from equine infectious anemia virus FEBS Lett 472, 312–316 25 Kurganov BI, Dorozhko AK, Kagan ZS & Yakovlev VA (1976) The theoretical analysis of kinetic behaviour of ‘hysteretic’ allosteric...

Ngày tải lên: 18/02/2014, 16:20

11 577 0
Tài liệu The 2012 Nexus Event – An Unknown Form Of Energy Is Coming Our Way pdf

Tài liệu The 2012 Nexus Event – An Unknown Form Of Energy Is Coming Our Way pdf

... of so visible changes occurring in our system? -The Mayas would clearly say: Yes! They will also say that colossal emissions of “unknown form of energy” will arrive from the center of the Milky ... center of the Milky Way, which will change the fundamentals of the physics of our world, new material and immaterial conditions for life which will last till the end of the next cycle On 21.12.2012 ... simulations utilizing the collection of knowledge, we have decades of galactic models and satellite data, tells us that our solar system will definitely began passing through the galactic plane in the...

Ngày tải lên: 19/02/2014, 03:20

329 684 0
Tài liệu Báo cáo khoa học: Expression and function of Noxo1c, an alternative splicing form of the NADPH oxidase organizer 1 doc

Tài liệu Báo cáo khoa học: Expression and function of Noxo1c, an alternative splicing form of the NADPH oxidase organizer 1 doc

... intracellular localization of Noxo1b after treatment of the cells with PMA, as the cells became rounded without detaching from coverslips To biochemically assess the localization of Noxo1s after ... multilabel counter Wallac 1420 ARVOsx (PerkinElmer Life Sciences, Turku, Finland) Estimation of expression of cytosolic regulatory proteins Total cell lysates of transfected CHO cells were used ... unstimulated cells Noxo1β Blot: anti-HA (+) Noxo1β (–) Noxo1γ PMA: Noxo1β C Noxo1γ B Noxo1β Fig Intracellular localization of Noxo1b and Noxo1c in CHO cells (A) Intracellular localization of Noxo1b...

Ngày tải lên: 19/02/2014, 06:20

15 633 0
Tài liệu Báo cáo khoa học: A zymogen form of masquerade-like serine proteinase homologue is cleaved during pro-phenoloxidase activation by Ca2+ in coleopteran and Tenebrio molitor larvae docx

Tài liệu Báo cáo khoa học: A zymogen form of masquerade-like serine proteinase homologue is cleaved during pro-phenoloxidase activation by Ca2+ in coleopteran and Tenebrio molitor larvae docx

... solution of Blue-Sepharose column; lane 4, lg of the active fractions of Mono-Q FPLC column The molecular size markers are indicated to the right in kDa Fig (A) Elution pattern of Mono-Q FPLC column ... solution; lane 2, the eluate solution of Toyopearl CM-650; lane 3, flow-through fractions of Toyopearl CM-650; lane 4, eluate solution of Blue-Sepharose CL-6B column, lane 5, active fraction of ... residues of the disulfide-knotted motif of Tm-PPAF-I are also conserved with those of other disulfide-knotted motifs 4380 K Y Lee et al (Eur J Biochem 269) Ó FEBS 2002 Fig Alignment of the catalytic...

Ngày tải lên: 21/02/2014, 03:20

9 463 0
Báo cáo khoa học: Crystal structures of the apo form of b-fructofuranosidase from Bifidobacterium longum and its complex with fructose pot

Báo cáo khoa học: Crystal structures of the apo form of b-fructofuranosidase from Bifidobacterium longum and its complex with fructose pot

... V-LPDSINVV-DKLKKKNVKLTNKKPIKTN-FKGS-TGLFDFNITFKVLNLNVS PGKTHFDILI-NSQ VREVERLRTKQVKNLRN-KVLKSGSRLEVYGV T-AAQADVEVLFKVRDLEKADVIEPSWTDPQLICSKMNVSVKSGLGPFGLMVLASK VEEIEELRQN-QVNLQN-KNLKPGSVLEIHGI A-ASQADVTISFKLEGLKEAEVLDTTLVDPQALCNERGASSRGALGPFGLLAMASK ... VDELLALRKR-KVFETA-KS -GTFLL-D VKENSYEIVCEFSG EIELRM-GNE QEAWSSISNKRPIYSRTFKTLS-EGSTNTT-T T-GETFKVDLSFSAK -SKASTFAIALRASA V-LPDSINVV-DKLKKKNVKLTNKKPIKTN-FKGS-TGLFDFNITFKVLNLNVS ... TNRIRAFLDSCSVEFFFND NF -TEQTLVGYDFA -KQQIFLDRTHSGD -VSFDET FASVYHGPLT PDST -GVVKLSIFVDRSSVEVFGGQ ELNSSVDSIKIGFDSS -QSSFYIDRH-IPN -VEFPRKQFFTDKLAAYL -EPLDYDQDLRVFSLYGIVDKNIIELYFND NL -EEYTSVYFRIFKARQNSNKYVVLMCSDQSRSSLKEDN...

Ngày tải lên: 06/03/2014, 00:21

17 522 0
Báo cáo khoa học: DNA polymerase e associates with the elongating form of RNA polymerase II and nascent transcripts pot

Báo cáo khoa học: DNA polymerase e associates with the elongating form of RNA polymerase II and nascent transcripts pot

... a-amanitin blocks cells specifically in the G1 phase of the cell cycle This effect could be attributed to inhibition of transcription of cell cycle-regulated genes at this phase of the cell cycle [51] ... polyclonal Mouse monoclonal Mouse monoclonal Mouse monoclonal Rabbit polyclonal Rabbit polyclonal X-LINK WB X-LINK, WB IP IP, X-LINK, WB, IEM IF, WB WB IP IP, WB, IF, IEM H5 Mouse monoclonal, ... Dickinson, Helsinki, Finland) of propidium iodide-stained cells [65] in parallel cell cultures Where indicated, cells were cultured in the presence of the indicated concentrations of one of the...

Ngày tải lên: 07/03/2014, 11:20

15 584 0
Báo cáo khoa học: Purification and structural study of the b form of human cAMP-dependent protein kinase inhibitor pdf

Báo cáo khoa học: Purification and structural study of the b form of human cAMP-dependent protein kinase inhibitor pdf

... present in fractions from bacterial cultures containing human PKIb expression vectors A, 2.5 lL of markers; B, lL of the crude extract from the cells; C, lL of heattreated crude extract; D, lL of (NH4)2SO4 ... (NH4)2SO4 fractionation; E, lL of DEAE eluate; F, 10 lL of DEAE eluate Fractions were analyzed by SDS/PAGE (12%) followed by staining with Coomassie Brilliant Blue An arrow indicates the position of ... Specific testicular cellular localization and hormonal regulation of the PKI and PKI isoforms of the inhibitor protein of the cAMP-dependent protein kinase J Biol Chem 272, 20011–20020 Byler, D.M &...

Ngày tải lên: 07/03/2014, 15:20

6 531 0
Báo cáo khoa học: The propeptide in the precursor form of carboxypeptidase Y ensures cooperative unfolding and the carbohydrate moiety exerts a protective effect against heat and pressure pot

Báo cáo khoa học: The propeptide in the precursor form of carboxypeptidase Y ensures cooperative unfolding and the carbohydrate moiety exerts a protective effect against heat and pressure pot

... were determined from DSC analysis of Dgly proCPY revealed a perfectly symmetrical single peak (Fig 1A), indicating that the thermal unfolding process of the precursor form follows a two- state transition ... ratio of the unfolding enthalpy (DHcal) to the van’t Hoff enthalpy (DHv) was 1.05 (DHcal and DHv values were 585 and 557 kJÆmol)1, respectively) In contrast, a DSC analysis of the mature form ... unfolding (Fig 2A) Their pressure-induced unfoldings also clearly followed a two- state transition (Fig 3A) Although the X-ray crystal structure of proCPY has not yet been solved, it is naturally...

Ngày tải lên: 07/03/2014, 21:20

7 439 0
Effects of initial form of chromium on electrokinetic remediation in clays

Effects of initial form of chromium on electrokinetic remediation in clays

... potential of catholyte was decreased for both kaolin and glacial till The redox potential of anolyte ranged from 250 to 450 mV for kaolin and from 450 to 500 mV for glacial till The redox potential of ... presents the results of a laboratory investigation performed to systematically evaluate the effects of the initial form of chromium on electrokinetic remediation efficiency Laboratory electrokinetic ... in glacial till was quite different from that of kaolin as seen in Fig 3b The initial pH of glacial till prior to electrokinetic treatment ranged from 6.74 to 7.36 (Table 2) After the electrokinetic...

Ngày tải lên: 16/03/2014, 00:07

13 404 0
Effects of innital form of chromium on electrokinetic remediation in clays

Effects of innital form of chromium on electrokinetic remediation in clays

... potential of catholyte was decreased for both kaolin and glacial till The redox potential of anolyte ranged from 250 to 450 mV for kaolin and from 450 to 500 mV for glacial till The redox potential of ... presents the results of a laboratory investigation performed to systematically evaluate the effects of the initial form of chromium on electrokinetic remediation efficiency Laboratory electrokinetic ... in glacial till was quite different from that of kaolin as seen in Fig 3b The initial pH of glacial till prior to electrokinetic treatment ranged from 6.74 to 7.36 (Table 2) After the electrokinetic...

Ngày tải lên: 16/03/2014, 00:07

13 613 0
Effects of innitial form of cr on electrokinetic remediation in clays

Effects of innitial form of cr on electrokinetic remediation in clays

... potential of catholyte was decreased for both kaolin and glacial till The redox potential of anolyte ranged from 250 to 450 mV for kaolin and from 450 to 500 mV for glacial till The redox potential of ... presents the results of a laboratory investigation performed to systematically evaluate the effects of the initial form of chromium on electrokinetic remediation efficiency Laboratory electrokinetic ... in glacial till was quite different from that of kaolin as seen in Fig 3b The initial pH of glacial till prior to electrokinetic treatment ranged from 6.74 to 7.36 (Table 2) After the electrokinetic...

Ngày tải lên: 16/03/2014, 00:07

13 254 0
w