world who fancy that the earthly bodies of men cannot be transferred to a heavenly habitation
báo cáo khoa học: " Can the ubiquitous power of mobile phones be used to improve health outcomes in developing countries" pps
Ngày tải lên :
11/08/2014, 18:20
... thirds of the requested diary data [28] "The combination of SMS data collection and a traditional Web page for data display and system customization may be a better and more usable tool for patients ... received asthma education, self-management plan, and standard treatment All measured PEF three times daily and kept a symptom diary In the study group, therapy was adjusted weekly by an asthma specialist ... it may not be practical to have a conversation Forms of payment and market potential The standard way of paying for a mobile phone service in the United States and Europe is on the basis of a minimum...
- 14
- 401
- 0
Tài liệu Báo cáo khoa học: The chitinolytic system of Lactococcus lactis ssp. lactis comprises a nonprocessive chitinase and a chitin-binding protein that promotes the degradation of a- and b-chitin doc
Ngày tải lên :
18/02/2014, 08:20
... Vaaje-Kolstad et al containing 100 lm of (GlcNAc)14 was analysed at the start, in the middle and at the end of each series of samples The resulting average values of the standards (displaying standard ... AGCCTTACAAGAAGGGTCCAAAGA-3Â) The PCR product was puried, treated with T4 exonuclease to create vector-compatible overhangs and annealed to a prepared expression vector (pET30 Xa LIC) provided by the ... initial phase was maintained longer than in the absence of LlCBP3 3A, indicating that LlCBP3 3A acts synergistically with LlChi1 8A However, the effect of LlCBP3 3A was small and ceased after approximately...
- 14
- 683
- 0
WHO guidelines on the pharmacological treatment of persisting pain in children with medical illnesses docx
Ngày tải lên :
07/03/2014, 04:20
... quality treatment educating health-care providers about the importance of pain assessment is necessary Pain assessment is a mandatory part of pain management similar to the assessment of vital ... barriers to pain management Classification and evaluation of pain It is important to classify and evaluate pain before deciding on pharmacological and non-pharmacological therapy Pain assessment Detailed ... of the pain management plan This permits the measurement of changes in the severity of pain over time, and the assessment of the adequacy and efficacy of the chosen treatment, and enables adjustments...
- 172
- 4K
- 0
ELA, Promissory Notes and All That: The Fiscal Costs of Anglo Irish Bank pdf
Ngày tải lên :
22/03/2014, 17:20
... majority of the IBRC’s debts—€48.2 billion of a total of €58.6 billion—are owed to central banks and the vast majority of these (€42.2 billion by my estimate) take the form of ELA. There has been a considerable focus in the media and popular discussions on payments to ... category of assets is the loans that it has made to banks. 7 The right‐hand‐side of the balance sheet shows the total amount of money that the central bank has created over time as well as the residual value by which the bank’s assets exceed the money ... monetary policy meeting. Haircuts are applied to the collateral so that the amount that is loaned to the borrowing bank is less than the value of the asset, 8 with the amount that ...
- 28
- 322
- 0
Báo cáo y học: "The prognostic value of blood lactate levels relative to that of vital signs in the pre-hospital setting: a pilot study" docx
Ngày tải lên :
13/08/2014, 11:23
... mortality Primary data analysis Because lactate levels were not normally distributed, they were logarithmically transformed before analysis To evaluate the prognostic accuracy of the lactate levels, ... characteristics of the remaining 124 patients are described in Table The mean (standard deviation) time at the scene from arrival to departure of the ambulance was 16 (8) minutes Mean duration of the subsequent ... cardiac arrest In addition, this would correct for possible negation of the association of tachycardia with mortality because of the coding of heart rate as in cases of cardiac arrest Twelve patients...
- 7
- 269
- 0
In this paper, we investigate the relationship between migration and species distribution in multizone environment. We present a discrete model for migration of three competing species over three zones. We prove that the migration tactics of species leads
Ngày tải lên :
16/10/2015, 09:09
... the dormant has the same failure rate as an operating one, and it is called ”warm” otherwise • FDEP The FDEP gate has one main input connected to a component or another gate and it has several ... the system is down and False when it is operational It is the value carried by the root of the DFT Due to these new gates the static analysis based on cut sets and the Markov chain approach are ... distinct, therefore it is not trivial to lump the Markov chain of the DFT In some sense we are interested to solve the hardest model of the Markov chain associated to the DFT We also assume that the...
- 8
- 292
- 0
Báo cáo khoa học: "The clinical value of daily routine chest radiographs in a mixed medical–surgical intensive care unit is low"
Ngày tải lên :
25/10/2012, 10:39
... not aware of this part of the observation As a consequence, the clinical relevance of the predefined abnormalities could not be evaluated in some cases, specifically in case of large atelectasis ... make changes in daily management of their patients in the present study; instead, we observed whether abnormalities on the CXRs led to a change in therapy We believe that this is a more accurate ... Predefined major abnormalities are summarized in Table aAbsolute number of chest radiographs (% of all daily routine chest radiographs) bAbsolute number of patients (% of all patients with daily routine...
- 7
- 722
- 0
Tài liệu The Investing Secrets of Warren Buffett—and how to profit from them pptx
Ngày tải lên :
09/12/2013, 20:15
... of stocks to leave your head in a spin You’ll just get a handful of the best investments available in the market place today with a summary of their features that make them stand out Valued at ... they fear that inflation will eat away at their capital that they have worked for over the years, the capital that they hoped to retire on or pass on to their family Believe me, I understand these ... the best Then there are others who deliberately not want to know anything about the activities of the company They want to study the “pure” movement of the stock price with the belief that they...
- 27
- 618
- 1
Tài liệu Báo cáo khoa học: Understanding the binding properties of an unusual metal-binding protein ) a study of bacterial frataxin pdf
Ngày tải lên :
18/02/2014, 16:20
... spectrum of CyaY, but the most striking consequence of the addition was the total disappearance of specific resonances without the concomitant appearance of other signals in other parts of the spectrum ... ratios: at a : Fe2+ ⁄ protein ratio, the resonances of Arg20, Asp22 and Asp23 disappeared, and the resonance of Leu21 shifted At a : ratio, the resonances of residues 19 and 44 also disappeared, ... the same peaks that are affected in the titration of the apoprotein We observed, in particular, the disappearance of residue 23 This suggests that Mn2+ can displace Ca2+ at very low concentrations,...
- 12
- 704
- 0
Báo cáo khoa học: The hyperfluidization of mammalian cell membranes acts as a signal to initiate the heat shock protein response pptx
Ngày tải lên :
07/03/2014, 12:20
... Suhan PJ (1985) Morphological study of the mammalian stress response: characterization of changes in cytoplasmic organelles, cytoskeleton, and nucleoli, and appearance of intranuclear actin filaments ... [13] The overexpression of a desaturase gene in Saccharomyces cerevisiae, or the addition of exogenous fatty acids, can change the unsaturated ⁄ saturated fatty acid ratio and exert a significant ... Enhanced Ras maturation by heat stress was associated with a heightened activation of extracellular signal-regulated kinase (ERK), a key mediator of both mitogenic and stress signaling pathways,...
- 10
- 452
- 0
Báo cáo khoa học: Binding of the volatile general anesthetics halothane and isoflurane to a mammalian b-barrel protein doc
Ngày tải lên :
07/03/2014, 16:20
... From mass law considerations, it then follows that Q¼ ðQmax [Halothane]Þ ðKd þ [Halothane]Þ ð1Þ Halothane displacement of bound AMA The dissociation constant of the complex between halothane and ... from the baseline on addition of halothane and isoflurane indicate that heat was evolved (an exothermic process) The enthalpy change associated with each injection of anesthetic was plotted vs the ... Johansson et al on global protein dynamics, with the goal of further defining a potential mechanism of volatile general anesthetic action Results Binding of the volatile anesthetic halothane to the...
- 9
- 421
- 0
The New Rules of Marketing and PR: How to use news releases, blogs, podcasts, viral marketing and online media to reach your buyers directly pptx
Ngày tải lên :
23/03/2014, 03:20
... Marketers at the most enlightened organizations recognize the fact that they are now purveyors of information and they manage content as a valuable asset with the care a publishing company does One of ... solves and proof that it works as advertised – in plain language Your marketing and PR is meant to be the beginning of a relationship with buyers and to drive action (such as generating sales leads), ... important; mainstream media and the trade press must be part of an overall communications strategy In some businesses, mainstream media and the trade press remain critically important and, of course,...
- 22
- 562
- 0
Báo cáo khoa học: The functional genomics of guanylyl cyclase⁄natriuretic peptide receptor-A: Perspectives and paradigms potx
Ngày tải lên :
28/03/2014, 23:20
... Kishimoto I, Saito Y, Harada M, Kuwahara K, Izumi T, Takahashi N, Kawakami R, Tanimoto K, Nakagawa Y et al (2002) Guanylyl cyclase -A inhibits angiotensin II type 1A receptor-mediated cardiac remodeling, ... postulated that the binding of ANP to the extracellular domain of the receptor causes a conformational change, thereby transmitting the signal to the GC catalytic domain (GCD); however, the exact ... isoproterenol and aortic constriction on mouse hearts J Biol Chem 278, 47694– 47699 Nakanishi M, Saito Y, Kishimoto I, Harada M, Kuwahara K, Takahashi N, Kawakami R, Nakagawa Y, Tanimoto K, Yasuno S et al...
- 16
- 635
- 0
the competitive advantage of firms and their proximity to export finance centers
Ngày tải lên :
03/06/2014, 02:14
... value, whereas the commercial bank making the loan retains 10% of the risk These loans are made to companies that are located in the United States that are exporting products that have at least ... environments about local or regional markets The distance between a service professional and the client adds to the costs of the transaction whether a consultant or a trade finance professional and ... Buffalo despite the fact that there are several large banks headquartered there It is reasonable to suspect that trade finance specialists are heavily concentrated in a handful of large cities that...
- 120
- 360
- 0
báo cáo sinh học:" The double burden of human resource and HIV crises: a case study of Malawi" docx
Ngày tải lên :
18/06/2014, 17:20
... contracts and payment due to administrative delays One problem was that the promised 52% salary top-up was not translated into a 52% increase in take-home pay because of changes to the tax and allowance ... Government of Malawi, Ministry of Health and Population: Malawi National Health Accounts: a broader perspective of the Malawian Health Sector 2001 Government of Malawi, Ministry of Health and Population: ... Note: All data for latest available year For countries where data on the number of health management and support workers were not available, estimates have been made based on regional averages...
- 13
- 585
- 0
Báo cáo hóa học: " Contribution of cysteine residues in the extracellular domain of the F protein of human respiratory syncytial virus to its function" docx
Ngày tải lên :
20/06/2014, 01:20
... -RRRRFAGVVIGLAALGVATAAQVTAAVALVKANENAAAILNLKNAIQKTNAAVADVVQATQSLGTAVQAVQDHINSVVSPAITAANCKAQDAIIGSILNLY SSRRHKRFAGVVLAGAALGVATAAQITAGIALHQSMLNSQAIDNLRASLETTNQAIEAIRQAGQEMILAVQGVQDYINNELIPSMNQLSCDLIGQKLGLKLLRY ... -RHKRFAGIAIGIAALGVATAAQVTAAVSLVQAQTNARAIAAMKNSIQATNRAVFEVKEGTQRLAIAVQAIQDHINTIMNTQLNNMSCQILDNQLATSLGLY GRQGRLIGAIIGGVALGVATAAQITAAAALIQAKQNAANILRLKESIAATNEAVHEVTDGLSQLAVAVGKMQQFVNDQFNKTAQELDCIKIAQQVGVELNLY ... -EQIENPRQSRFVLGAIALGVATAAAVTAGVAIAKTIRLESEVTAIKNALKKTNEAVSTLGNGVRVLATAVRELKDFVSKNLTRAINKNKCDIADLKMAVSFSQF E -ARIMSPRKARFVLGAIALGVATAAAVTAGVAIAKTIRLEGEVAAIKGALRKTNEAVSTLGNGVRVLATAVNDLKDFISKKLTPAINRNKCDISDLKMAVSFGQY TNPRTKRFFGGVIGTIALGVATSAQITAAVALVEAKQARSDIEKLKEAIRDTNKAVQSVQSSIGNLIVAIKSVQDYVNKEIVPSIARLGCEAAGLQLGIALTQH...
- 11
- 343
- 0
Báo cáo vật lý: "The Hidden Property of Arrhenius-type Relationship: Viscosity as a Function of Temperature" doc
Ngày tải lên :
07/08/2014, 14:20
... order to increase the accuracy of the measurement because a lower speed would have increased the fluctuation of the viscosity readings A temperature controller (temperature accuracy of ±1°C) was ... (5) has a similar value and unit to that of equation (1) R is the gas constant, and is equal to 8.314 J/mol/K To is the viscosity at temperature To which, in this study, has been taken as the ... his thanks to those who have indirectly contributed to this research They are: Ms Azira Amran, Mr Mahmood Sulaiman, Mrs Siti Zalaikhar, Mr Rozimi and Ms Mazalina Viscosity as a Function of Absolute...
- 10
- 496
- 1
Báo cáo toán học: "The maximum number of perfect matchings in graphs with a given degree sequence" docx
Ngày tải lên :
07/08/2014, 15:22
... all-1 matrix Proof of Theorem 1.1: The square of the number of perfect matchings of G counts ordered pairs of such matchings We claim that this is the number of spanning 2-regular subgraphs H of ... to the permanent) Thus the square of the number of perfect matchings is at most the permanent of the adjacency matrix, and the desired inequality follows from Bregman-Minc by taking the square ... came from M1 and which from M2 The permanent of the adjacency matrix A of G also counts the number of spanning 2-regular subgraphs H of G, where now we allow odd cycles and cycles of length as...
- 2
- 367
- 0
Báo cáo lâm nghiệp: "Morphological and functional variability in the root system of Quercus ilex L. subject to confinement: consequences for afforestation" ppt
Ngày tải lên :
08/08/2014, 00:22
... restriction to growth An intermediate length of 60 cm (hereafter, MT) was also used A galvanized mesh was placed at the bottom of the tubes to prevent substrate movement and to facilitate root air pruning ... between LT and MT were not significant Overall, KRR and KRL took similar values for a particular tube type due to the similarity between leaf surface and root surface areas The correlation analysis ... lateral roots in the container and their downward growth lead to the generation of an orthogeotropic lateral root system rather than the more usual plagiotropic one that originates from the taproot...
- 6
- 371
- 0