vodafone s thought process and general approach to engagement

... observations are used to calculate the observation centroid Moreover, it uses only observation association as missing data, which simplifies E-step and M-step [24] and consequently, it reduces ... observation process and the state process, respectively Yt is a set of all observation set for time t ≥ 1, where t is current time Yt and Φt represent the realization of the observation process ... Here, Φ (s) represents the combined state vector of a target s So, the parameter Φ (s) is the set of parameters (φ1 (s) , φ2 (s) , , φM (s) ), where φm (s) is the state vector of target s due to model...

Ngày tải lên: 22/06/2014, 19:20

... chứng Parkinson, atropine, scopolamine, amantadine (Amantan), antipsychotics, thuốc chống trầm cảm (antidepressants), thuốc chống co thắt (antispasmodics), thuốc giãn đồng tử (mydriatics), thuốc ... (Bites/envenomations) : 4,2 % Thuốc an thần/Thuốc ngủ/Thuốc chống loạn tâm thần : 4,1 % Thuốc dùng chỗ (topicals) : 4,1 % Thuốc trừ s u (pesticides) : 4% Thuốc chống trầm cảm (antidepressants) ... chế cholinesterase Nhóm thuốc trừ s u gồm có organophosphates carbamates, thường tìm thấy thuốc trừ s u gia dụng Atropine s dụng để làm khô dịch tiết, chủ yếu phổi, pralidoxime chủ yếu s dụng...

Ngày tải lên: 13/07/2014, 16:20

... chứng Parkinson, atropine, scopolamine, amantadine (Amantan), antipsychotics, thuốc chống trầm cảm (antidepressants), thuốc chống co thắt (antispasmodics), thuốc giãn đồng tử (mydriatics), thuốc ...  Thuốc trừ s u (pesticides) : 4%  Thuốc chống trầm cảm (antidepressants) : 3,9 %  Thức ăn, ngộ độc thức ăn : 3,1 %  Cồn (alcohols) : 2,9 %  Hydrocarbons : 2,8 %  Antihistamines : 2,7 %  ... chế cholinesterase Nhóm thuốc trừ s u gồm có organophosphates carbamates, thường tìm thấy thuốc trừ s u gia dụng Atropine s dụng để làm khô dịch tiết, chủ yếu phổi, pralidoxime chủ yếu s dụng...

Ngày tải lên: 26/07/2014, 17:21

... (pDCs) can internalise viral antigens and present them on major histocompatibility complex (MHC) class I to CD8+ T-cells to enhance host immune responses [23] These defence mechanisms when work together ... Antibody response to influenza infection In the host, infection by an influenza virus triggers a series of immune responses to counteract the invading virus Antibody response has been shown to play ... membranes, which is essential for the virus life cycle [8] HA is synthesised as a single peptide but cleaved into HA1 and HA2 by specific host protease The amino acids at the cleavage site are...

Ngày tải lên: 12/08/2014, 04:21

... QLGNCSVAGWILGNPECELLISKESWSYIVEKPNPENGTCYPGHFADYEE Site C Site E LREQLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIW 150 X XXXX X X X X XX X X LREQLSSVSSFERFEIFPKESSWPNHTVT-GVSASCSHNGESSFYRNLLW Site A LVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVF ... release of newly produced virus from surface receptors and to digest mucous secretions, allowing the virus better access to the surface of susceptible cells and spread through the respiratory ... genotypes, these segments can almost randomly reassort resulting in hybrid genotypes with some segments derived from one virus strain, while the other segments are derived from a second strain Less...

Ngày tải lên: 12/08/2014, 04:21

... calls No assumptions are made in cases in which data on presumed diagnosis were missing Proposed minimum standards for managing a MET call The proposed minimum standards were developed after a series ... beginning basic resuscitation They are also encouraged to call for help if needed After initial resuscitation and assessment, the staff are instructed to discuss the case with appropriate medical staff, ... their effects in reducing cardiac arrests and serious adverse events [1], primarily in single-centre studies Limited information exists on the cause of MET calls, and there is even less information...

Ngày tải lên: 12/08/2014, 23:21

... Feasibility and efficacy of a new non-invasive surface cooling device in post-resuscitation intensive care medicine Resuscitation 2007, in press Kuboyama K, Safar P, Radovsky A, Tisherman SA, Stezoski ... out-of-hospital cardiac arrest using an endovascular cooling system Crit Care 2007, 11:R71 Bernard SA, Gray TW, Buist MD, Jones BM, Silvester W, Gutteridge G, Smith K: Treatment of comatose survivors ... Liaison committee on Resuscitation Resuscitation 2003, 57: 231-235 European Resuscitation Council: European Resuscitation Council guidelines for resuscitation 2005 Resuscitation 2005, 67 :S1 -S1 89...

Ngày tải lên: 13/08/2014, 08:20

... part: study design, subject of the study, data collection instruments as well as data collection analyzing process - Chapter 3: ANALYSIS, FINDINGS AND DISCUSSIONS This part focuses on presenting, ... analyzing and discussing the results obtained from the study - Part 3, CONCLUSIONS AND RECOMMENDATIONS, summarizes some major findings, provides recommendations for a possibly applicable approach to ... III: ANALYSIS, FINDINGS AND DISCUSSIONS 23 Data analysis 23 3.2 Findings and discussions 23 3.2.1 Teachers’ beliefs and knowledge in teaching pronunciation 23 3.2.2 Formal curricula description...

Ngày tải lên: 04/08/2015, 09:40

... Your success as a teacher is based entirely on their success as learners Co-ordination of English language departments Most institutions where teaching is generally successful have systems to set ... each lesson Some teachers begin most lessons with a review of the language items practised in the previous lesson This approach almost always starting lessons with a focus on language—tends to make ... materials from those countries, for example, magazine and newspaper articles, cassettes of songs, and videos of television programmes Of course, English does not ‘belong’ to any specific countries, societies,...

Ngày tải lên: 27/07/2016, 15:32

... and updates in contraceptive technology The course will use formal lectures, hands-on workshops, small group discussions, questions and answers and a detailed syllabus This course is presented by ... practice; and expanded skills in clinical examination and common office procedures The course will utilize formal lectures, hands-on workshops, case discussions, and questions and answers A detailed syllabus ... Reproductive Sciences, and Epidemiology & Biostatistics Jody Steinauer, MD Assistant Professor of Obstetrics, Gynecology & Reproductive Sciences Judith M E Walsh, MD, MPH Associate Professor of Clinical...

Ngày tải lên: 14/03/2014, 14:20

... r sin x1 cos x2 y3 = r sin x1 sin x2 cos x3 yn-1 = r sin x1 sin x2 sin x3 sin x4 cos xn-1 yn = r sin x1 sin x2 sin x3 sin x4 sin xn-1 cos xn yn+1 = r sin x1 sin x2 sin x3 sin x4 sin xn-1 sin ... xn) 42 3 = (0, 0, -r sin x sin x sin x , r sin x sin x cos x cos x , x r sin x1 sin x2 cos x3 sin x4 sin xn-1 cos xn, r sin x1 sin x2 cos x3 sin x4 sin xn-1 sin xn), and so on g11 g22 g33 ... and < xn < 2, given by y1 = cos x1 y2 = sin x1 cos x2 y3 = sin x1 sin x2 cos x3 yn-1 = sin x1 sin x2 sin x3 sin x4 cos xn-1 yn = sin x1 sin x2 sin x3 sin x4 sin xn-1 cos xn yn+1 = sin x1 sin...

Ngày tải lên: 17/03/2014, 14:28

Ngày tải lên: 22/03/2014, 23:21

... activator Ste12 and its repressors Dig1 ⁄ Rst1 and Dig2 ⁄ Rst2 [15–19] (Fig 1) Pheromone Starvation membrane Receptor Ste20 Ste11 Gα Ste20 Sensor Ste11 Gβγ Ste5 Ste7 Ste7 Fus3 Kss1 cytosol Dig1/2 Ste12 ... courses of Fus3PP, Kss1PP, PREPs and FREPs with respect to all parameters Table S4 Sensitivity analysis of crosstalk measures (CM) C,F,SK, Si and Se with respect to the activation measures (AM), time ... v18 Kss1 c12 Ste12 Ste12 v1 Ste11 v7 v8 c9 Kss1 Ste12 Kss1 Kss1 c Ste12 Ste12 17 Ste11 v26 c4 Kss1 c 15 PP v4 Gβγ Ste5 P Kss1 Kss1 Ste11 v1 Gβγ c12 c7 Tec1 FREP c24 v31 Fig Graphical representation...

Ngày tải lên: 30/03/2014, 10:20

... A is η-strongly monotone If A is η-strongly monotone and κ-Lipschitz continuous, that is, Ax − Ay ≤ κ x − y for all x, y ∈ C, then A is η/κ2 inverse-strongly monotone If A is an α-inverse-strongly ... For such a case, A is called α-inverse-strongly monotone We know that if A I −T , where T is a nonexpansive mapping of C into itself and I is the identity mapping of H, then A is 1/2-inverse-strongly ... which is a solution of a certain optimization problem Applications of the main result are also discussed Our results improve and complement the corresponding results of Chen et al , Iiduka and Takahashi...

Ngày tải lên: 21/06/2014, 11:20

... cos x2 sin x3 … sin xn-1 sin xn) ∂ 3 = (0, 0, -r sin x sin x sin x , r sin x sin x cos x cos x , ∂x r sin x1 sin x2 cos x3 sin x4… sin xn-1 cos xn, r sin x1 sin x2 cos x3 sin x4 … sin xn-1 sin ... cos x y2 = r sin x1 cos x2 y3 = r sin x1 sin x2 cos x3 … yn-1 = r sin x1 sin x2 sin x3 sin x4 … cos xn-1 yn = r sin x1 sin x2 sin x3 sin x4 … sin xn-1 cos xn yn+1 = r sin x1 sin x2 sin x3 sin ... x cos x , r cos x sin x cos x , , ∂x r cos x1 sin x2… sin xn-1 cos xn, r cos x1 sin x2 … sin xn-1 sin xn) ∂ 2 n-1 cos xn, = (0, -r sin x sin x , , r sin x cos x sin x … sin x ∂x r sin x1...

Ngày tải lên: 12/08/2014, 16:20

... from t = a to t Then s is an invertible function of t, and, using s as a parameter, ||dxi/ds||2 is constant, and equals if C is space-like and -1 if it is time-like Conversely, if t is any parameter ... metric? Answer Since physical units of time are (usually) not the same as physical units of space, we would like to convert the units of x4 (the units of time) to match the units of the other axes Now, ... is a universal constant, it seems logical to use c as this conversion factor Now, if we happen to be living in a Riemannian 4-manifold whose metric diagonalizes to something with signature (1,...

Ngày tải lên: 12/08/2014, 16:20

... Christoffel Symbols of the First Kind Christoffel Symbols of the Second Kind Neither of these gizmos are tensors, but instead transform as follows (Which you will prove in the exercises!) Transformation ... ys,qr ys,p + ys,pq ys,r gpq,r = ys,rp ys,q + ys,qr ys,p Note that each term on the right occurs twice altogether as shown by the boxes This permits us to solve for the completely boxed term ys,pq ... length iff its coordinates with respect to the chart x are constant; that is, iff i dX = dt But, since for this coordinate system, gij = ©ij, the Christoffel symbols clearly vanish, and so i dXi...

Ngày tải lên: 12/08/2014, 16:20

... coordinate system) such that the Christoffel symbols vanish—at least in the domain of the chart? Answer This is asking too much; we shall see later that the derivatives of the Christoffel symbols give ... d “P, T‘ = (±1) = 0, ds as asserted Local Flatness, or “Local Inertial Frames” In “flat space” Es all the Christoffel symbols vanish, so the following question arises: Question Can we find a chart ... whose first curvature is zero is called a geodesic Thus, a geodesic is a curve that satisfies the system of second order differential equations    i  dxp dxq d2xi   + pq ds ds =   ds...

Ngày tải lên: 12/08/2014, 16:20

... the eyes of the observer, spacetime should be flat.) Question Does parallel transport preserve the relationship of these vectors to the curve That is, does the vector V(4) remain parallel, and the ... We think of V(4) as the unit vector in the direction of time, and V(1), V(2) and V(3) as the spatial basis vectors Using parallel translation, we obtain a similar set of vectors at each point along ... geodesic as timelike Looking at the discussion before Definition 7.1, we see that this corresponds, in Minkowski space, to a particle traveling at sub-light speed It follows that we can choose...

Ngày tải lên: 12/08/2014, 16:20

... T is a symmetric tensor Definition 11.4 Classically, a fluid has no viscosity if its stress tensor is diagonal in an MCFR (viscosity is a force parallel to the interfaces) Thus, for a viscosity-free ... measure stress by generalizing the classical formula F ∆F n stress = T (n ) = S for such a surface element Hopefully, the space-coordinates of the stress will continue to measure force The first ... )a, so that we can take u, w, and v to be the other three basis vectors This permits us to use the simpler formula (I) to obtain the coordinates Of interest to us is a more usable form—in terms...

Ngày tải lên: 12/08/2014, 16:20