therapy early treatment of acute hepatitis c or delayed treatment
Báo cáo y học: "Study of the early steps of the Hepatitis B Virus life cycle"
Ngày tải lên :
03/11/2012, 10:09
... into covalently closed circle DNA (cccDNA) The cccDNA is believed to be the template for further propagation of pre-genomic RNA, which directs the synthesis of viral DNA and mRNA that encode ... attachment sties [17] The cell receptor for HBV attachment It is also unclear as to the identity of the cellular macromolecules that are responsible for virus attachment Since HBV is highly infectious, ... binding capacity increased by orders of magnitude compared with untransfected cells Chinese hamster ovary cells, which normally not bind to HBV, acquired susceptibility to HBV binding after transfection...
- 13
- 654
- 1
Báo cáo khoa học: A ribonuclease zymogen activated by the NS3 protease of the hepatitis C virus potx
Ngày tải lên :
07/03/2014, 11:20
... Values of Tm for HCV zymogens were determined in NaCl Pi by CD spectroscopy b Values of Kd ( SE) were determined for the complex with pRI at 23 ( 2) C c Values of IC50 are for the incorporation of ... Meyhack B, Hemmings BA, Stone SR & Hofsteenge J (1990) Protein chemical and kinetic characterization of recombinant porcine ribonuclease inhibitor expressed in Saccharomyces cerevisiae Biochemistry ... the CD spectra of unactivated and activated 1C zymogen is difcult, activation of the 1C zymogen appears to have an effect on its CD spectrum and is thus likely to affect its conformation The conformational...
- 9
- 391
- 0
Báo cáo khoa học: Expression studies of the core+1 protein of the hepatitis C virus 1a in mammalian cells pot
Ngày tải lên :
30/03/2014, 03:20
... (antisense) C5 4 (antisense) GTGCTTGCGAATTCCCCGGGA CTCGAATTCAGTTGACGCCGTCTTCCAGAACC CGTAGACCGTGCACCAGCACGAATCCTAAAC GTTTAGGATTCGTGCTGGTGCACGGTCTACG CCTAAACCTCAAAAAAAAACAAACGTAACACC GGTGTTACGTTTGTTTTTTTTTGAGGTTTAGG ... GGTGTTACGTTTGTTTTTTTTTGAGGTTTAGG CCGGAATTCCGCCACCATGGCAATGAGGGCTGCGGGTGGGCGGG GGAATTCCAGCGGTTTAAACTCAATG CTCGAATTCAGTTCACGCCGTCTTCCAG CTCGAATTCCACTAGGTAGGCCGAAG PCR amplification of the myc-tagged HCV-1 core ⁄ core+1 sequence ... myc (+1) pHPI-1579 wild-type context gcccctctATG85g nt 590 core+1/S–myc CMV nt 825 core+1 optimal context ccgccaccATG85g nt 590 core+1/S nt 828 core+1 CMV pHPI-1580 optimal context ccgccaccATG85g...
- 18
- 365
- 0
Báo cáo sinh học: " The simultaneous presence and expression of human hepatitis C virus (HCV), human herpesvirus-6 (HHV-6), and human immunodeficiency virus-1 (HIV-1) in a single human T-cell" docx
Ngày tải lên :
18/06/2014, 18:20
... gtc ttc acg cag cac tcg caa cca ccc tat cag cca gcn cac aaa ggn ata gga gg acb acy gcn cct tch cct ttc ccc aat ccc ccc ttt tct tta aaa tt cgt aga aca gaa gac cgg c aga act gca aat cgt tcc g [5] ... HCV HCV HCV HIV HIV HIV HHV-6 HHV-6 HCV 9.1 HCV 9.2 HCV 10.1 HCV 10.2 Con-1f1 Con-1r1 Con-1r2 U16-17F U16-17R gac act cca cca tag atc act c cat gat gca cgc tct acg aga c ctg tga gga act act gtc ... particles First, characteristic cytopathic effects (CPE) on the cells were observed The cells have the appearance of a balloon, called "juicy cells" (Figure 2) [10] Second, the cell culture supernatants...
- 8
- 410
- 0
Báo cáo sinh học: " Transmission of human hepatitis C virus from patients in secondary cells for long term culture" pot
Ngày tải lên :
19/06/2014, 08:20
... tag atc act c cat gat gca cgc tct acg aga c ctg tga gga act act gtc ttc acg cag cac tcg caa cca ccc tat cag act gtc ttc acg cag aag cgt cta gcc at cga gac ctc ccg ggg cac tcg caa gca ccc acg cag ... aaa gcg tct agc cat ggc gtt agt tcc cgg ggc act cgc aag cac cct atc agg ggg ccg ggc atg aga cac gct gtg ata aat gtc 1The primers were designed with the program PrimerSelect (DNASTAR) using conserved ... PCR conditions For each PCR, forty cycles of amplification were performed with the following temperature profiles: 94 C for min, 55 C for min, and 72 C for for the outer primer set and 94 C for...
- 17
- 479
- 0
Báo cáo hóa học: " The simultaneous presence and expression of human hepatitis C virus (HCV), human herpesvirus-6 (HHV-6), and human immunodeficiency virus-1 (HIV-1) in a single human T-cell" pptx
Ngày tải lên :
20/06/2014, 01:20
... gtc ttc acg cag cac tcg caa cca ccc tat cag cca gcn cac aaa ggn ata gga gg acb acy gcn cct tch cct ttc ccc aat ccc ccc ttt tct tta aaa tt cgt aga aca gaa gac cgg c aga act gca aat cgt tcc g [5] ... HCV HCV HCV HIV HIV HIV HHV-6 HHV-6 HCV 9.1 HCV 9.2 HCV 10.1 HCV 10.2 Con-1f1 Con-1r1 Con-1r2 U16-17F U16-17R gac act cca cca tag atc act c cat gat gca cgc tct acg aga c ctg tga gga act act gtc ... particles First, characteristic cytopathic effects (CPE) on the cells were observed The cells have the appearance of a balloon, called "juicy cells" (Figure 2) [10] Second, the cell culture supernatants...
- 8
- 446
- 0
Báo cáo hóa học: " Discovery of significant variants containing large deletions in the 5''''UTR of human hepatitis C virus (HCV)" pot
Ngày tải lên :
20/06/2014, 02:20
... retransmissions of HCV JGP performed the clinical work, recruitment of patients, and procurement of specimens DR, MOA, RSB, and DB performed the molecular work Acknowledgements The California Institute of ... Oncology Specialists, Ventura, CA for their continued efforts and support in our efforts to advance HCV research References WHO: Hepatitis C – global prevalence (update) Weekly Epidemiological ... EF028188 Declaration of competing interests All intellectual rights are reserved by the California Institute of Molecular Medicine (CIMM), and all aspects of this work were performed by CIMM There...
- 5
- 276
- 0
Báo cáo y học: "Clinical Profiles of Chronic Hepatitis C in a Major County Medical Center Outpatient Setting in United States" pptx
Ngày tải lên :
08/08/2014, 18:20
... with chronic HCV infection, a series of epidemiological, clinical and biochemical variables were collected at entry through a retrospective chart review The clinical variables collected included ... a significantly low incidence of cirrhosis than other ethnic groups Since African Americans represented a relative small portion of this cohort of patients, the clinical importance of this finding ... the Hepatitis Clinic at Los Angeles County-USC Medical Center between January 1990 and December 1998 The inclusion criteria included: chronic HCV infection demonstrated by anti-HCV and /or HCV...
- 9
- 388
- 0
Báo cáo y học: "Prevalence of active hepatitis c virus infection in district mansehra pakistan" docx
Ngày tải lên :
12/08/2014, 02:20
... 95 C for minutes followed by 30 cycles of 94 C for 45 seconds, 54 C for 45 seconds, and 72 C for minute performed in a thermal cycler (Eppendorf, Germany) The conditions for the 2nd round PCR ... manuscript to BioMed Central and take full advantage of: • Convenient online submission • Thorough peer review • No space constraints or color figure charges • Immediate publication on acceptance ... females is considered to play a role in the spontaneous clearance of HCV infection [34] Abbreviations cDNA: complementary DNA; HCV: hepatitis C virus; IBGE: Institute of Biotechnology and Genetic Engineering;...
- 5
- 268
- 0
Báo cáo y học: "Urine neutrophil gelatinase-associated lipocalin is an early marker of acute kidney injury in critically ill children: a prospective cohort study" pot
Ngày tải lên :
13/08/2014, 08:20
... Page of 11 (page number not for citation purposes) Available online http://ccforum.com/content/11/4/R84 Figure absence of sepsis Mean and peak uNGAL concentrations according to presence or absence ... creatinine clearance (eCCl) was calculated using the Schwartz formula [23] Patients were classified daily by pRIFLE criteria for AKI, using changes in eCCl from baseline eCCl (Table 1) Each patient's ... Goldstein SL: Worsening Renal Function in Children Hospitalized with Acute Decompensated Heart Failure: Evidence for a Pediatric Cardiorenal Syndrome? Pediatric Critical Care Medicine in press Schrier...
- 11
- 430
- 0
Báo cáo y học: "A new parameter using serum lactate dehydrogenase and alanine aminotransferase level is useful for predicting the prognosis of patients at an early stage of acute liver injury: A retrospective study" potx
Ngày tải lên :
13/08/2014, 13:20
... liver, which is believed to cause hepatic hypoxia as a result of disturbance of the microcirculation [9-12] Although the importance of over-activation of hepatic macrophages in the progression of ALF ... http://www.comparative-hepatology.com/content/7/1/6 city, and was superior to the MELD score, although the curve for the first day was close to the identity line corresponding to a complete lack of discriminative ... ROC curve of the ALT-LDH index for the third day was 0.893 while that of the MELD score was 0.777 (Table 2) In past reports evaluating the predictive efficacy of the MELD score for ALF, the cut-off...
- 8
- 282
- 0
Báo cáo y học: " Serum Interleukin-6 and interleukin-8 are early biomarkers of acute kidney injury and predict prolonged mechanical ventilation in children undergoing cardiac surgery: a case-control study" pps
Ngày tải lên :
13/08/2014, 16:21
... study of a cohort of children undergoing CPB for correction of congenital heart disease The cohort of patients was previously described and consists of patients with clear ischemic acute kidney ... levels Conclusions Receiver-operator mechanical ventilationcurve cardiopulmonary bypass (CPB) predict prolonged characteristic (ROC) after for the ability of IL-8 to predict prolonged mechanical ... Buurman WA: Tumor necrosis factor: function, release and clearance Crit Rev Immunol 1996, 16:1-11 Bocci V: Interleukins: clinical pharmacokinetics and practical implications Clin Pharmacokinet 1991,...
- 9
- 339
- 0
Báo cáo y học: " Urine interleukin-6 is an early biomarker of acute kidney injury in children undergoing cardiac surgery" pdf
Ngày tải lên :
13/08/2014, 21:21
... failure, vasopressor support, and successful coronary revascularization in predicting 30-day mortality of patients with cardiogenic shock complicating acute myocardial infarction Crit Care Med 2006, ... submission • Thorough peer review • No space constraints or color figure charges • Immediate publication on acceptance • Inclusion in PubMed, CAS, Scopus and Google Scholar • Research which is freely ... terms of predictive accuracy, an elevated IL-6 indicates a 60% probability of being diagnosed with AKI The C- statistic indicating the accuracy of IL-6 at six hours to properly classify cases...
- 13
- 505
- 0
Báo cáo y học: "Molecular basis of telaprevir resistance due to V36 and T54 mutations in the NS3-4A protease of the hepatitis C virus" pdf
Ngày tải lên :
14/08/2014, 08:20
... transcription-PCR (RT-PCR) assay (Taqman) with a pair of HCVspecific primers (5'-ACG CAG AAA GCG TCT AGC CAT-3' and 5'-TAC TCA CCG GTT CCG CAG A-3'), an HCV-specific probe (5'-6FAM-TCC TGG AGG CTG ... HCV_1a HCV_1b HCV_ 1c HCV_2a HCV_2b HCV_ 2c HCV_2k HCV_3a HCV_3b HCV_3k HCV_4a HCV_5a HCV_6a HCV_6b HCV_ 6c HCV_6g HCV_6h HCV_6k : : : : : : : : : : : : : : : : : : 140 100 * 120 * * 160 * PCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGIFRAAVCTRGVAKAVDFIPVENL ... important carbon atoms of the side chains are indicated as C , C and C Protein backbone changes are depicted in black The contribution of F43 to the hydrophobic cavity conformation and the cyclopropyl...
- 18
- 396
- 0
Diagnosis, Management, and Treatment of Hepatitis C: An Update docx
Ngày tải lên :
08/03/2014, 14:20
... Interpretation Acute or chronic HCV depending on the clinical context Resolution of HCV; Acute HCV during period of low-level viremia Early acute HCV infection; chronic HCV in setting of immunosuppressed ... Acute and Chronic HCV Infection and Interpretation of Assays The diagnosis of acute or chronic HCV infection generally requires testing of serum for both antibody to HCV (anti-HCV) and for HCV RNA ... (Manufacturer) Amplicor HCV Monitor (Roche Molecular Systems) Cobas Amplicor HCV Monitor V2.0 (Roche Molecular Systems) Versant HCV RNA 3.0 Assay (bDNA) (Siemens Health Care Diagnostics) LCx HCV...
- 40
- 998
- 0
báo cáo hóa học:" Improvement in quality of life measures in patients with refractory hepatitis C, responding to re-treatment with Pegylated interferon alpha -2b and ribavirin" docx
Ngày tải lên :
20/06/2014, 15:20
... Vitality Social Functioning Role-Emotional Mental Health Physical Component Score Mental Component Score National age/ sex adjusted mean Baseline End of treatment Score P value score P value Score P ... viremia is often considered for re -treatment with a newer interferon or combination treatment The decision to re-treat a patient for refractory hepatitis C infection is difficult and is influenced by ... received 1000 mg The entry criteria included chronic hepatitis C documented by a positive HCV RNA, abnormal liver tests and liver biopsy consistent with HCV Minimum hematological criteria included...
- 8
- 288
- 0
Báo cáo khoa học: "Comparison of conformal and intensity modulated radiation therapy techniques for treatment of pelvic tumors. Analysis of acute toxicity" pdf
Ngày tải lên :
09/08/2014, 09:20
... prospective clinical trials are important to corroborate the real benefit of IMRT in the treatment of Table Crude incidence of acute GU toxicity in both groups according to RTOG/EORTC acute radiation ... cancer [5,11], anal canal cancer [9,13] and bladder cancer [12] However, the main Table Crude incidence of acute GU toxicity in both groups according to RTOG/EORTC acute radiation morbidity criteria ... http://www.ro-journal.com/content/5/1/117 Page of Table Crude incidence of acute GI toxicity in both groups according to RTOG/EORTC acute radiation morbidity criteria in patients with rectal cancer Grade...
- 7
- 331
- 0
Báo cáo y học: "Further benefits by early start of HIV treatment in low income countries: Survival estimates of early versus deferred antiretroviral therapy" potx
Ngày tải lên :
10/08/2014, 05:21
... Income Countries (ART-LINC) Collaboration; ART Cohort Collaboration (ART-CC) groups: Mortality of HIV1-infected patients in the first year of antiretroviral therapy: comparison between low-income ... advantage of: • Convenient online submission • Thorough peer review • No space constraints or color figure charges • Immediate publication on acceptance • Inclusion in PubMed, CAS, Scopus and Google Scholar ... treatment indications need to be assessed systematically Life years gained by different CD4 starting points is necessary information for making informed choices about early or late start of treatment...
- 9
- 276
- 0
Báo cáo y học: " Reliability and predictive validity of a hepatitisrelated symptom inventory in HIV-infected individuals referred for Hepatitis C treatment." docx
Ngày tải lên :
10/08/2014, 05:22
... differences in HCV genotype or viral load, HIV risk factor, CD4 cell count, race/ethnicity, proportion of patients with psychiatric histories, or prior or current illicit substance use comparing HCV treated ... showed that the correlation of neuropsychiatric symptom score with CES-D scores was significantly different from the correlations of somatic and sleep symptom scores with CES-D scores (p = 0.001) ... HCV symptom inventory scores not change on HCV treatment To identify baseline predictors of HCV treatment initiation we used analysis of variance and Fisher’s test for continuous and categorical...
- 9
- 483
- 0