the skilled know how of managing a crisis

... imitation leather), and optionally a zipper to make a pair of jeans An average jeans factory can make about 2.500 pair of jeans per day A stonewash for 150 pairs of jeans takes 150 kilos of pumice ... Benin is one of several cotton‐growing countries in west Africa, and there is  a permanent carnival air. Here, parrot‐bright robes make a blessed change  from the drab American cast‐offs that dress the rest of the continent. But a closer look at Benin's cotton industry, the mainstay of its economy, is not  ... perhaps just as well, for what would you put, if you really knew? "Made in Tunisia, Italy, Germany, France, Northern Ireland,  Pakistan, Turkey, Japan, Korea, Namibia, Benin, Australia and Hungary"?    The shop you’ve just purchased the jeans from is the last stop on a journey which, if it were put end to end, would go round ...

Ngày tải lên: 09/08/2015, 01:23

Ngày tải lên: 23/10/2013, 14:11

... poly (A) catalyzed by yeast poly (A) polymerase The relative activity of diadenosine polyphosphates as effectors of the poly (A) synthesis was assayed as in Fig 4, using 0.05 mM [a- 32P]ATP as substrate, ... the assay after incubation These results show that a concentration as low as 0.001 mM Gp2G stimulates, under these conditions, the synthesis of poly (A) catalyzed by yeast poly (A) polymerase around ... one of them treated with phosphodiesterase The three samples involved were analyzed by HPLC The amount of ATP in the control, indicates the ATP present at the start of the reaction (Fig 2A) ; the...

Ngày tải lên: 21/02/2014, 01:21

... selectivity Tomatsu H, Takano J, Takahashi H, Watanabe-Takahashi A, Shibagaki N & Fujiwara T (2007) An Arabidopsis thaliana high-affinity molybdate transporter required for efficient uptake of molybdate from ... -MASSPTKILCDAGESDLCRDDAAAFLLKFVAIASIL 1:MFFIDVLWKLFPLYLFGSERDYLSETESILKIVPETMAAASSLSILCDAGEPDLCRDDSAAFLLKLVAIASIF TjZNT1 TjZNT2 37:LAGVAGVAIPLIGKNRRFLQTEGNLFVAAKAFAAGVILATGFVHMLAGGTEALTNPCLPDYPWSKFPFPGFFA ... showed no increase in manganese accumulation (Fig 5B) The strain expressing DN36 had an increased zinc content and measurement of the 65Zn uptake of cells showed that the 65Zn accumulation of...

Ngày tải lên: 29/03/2014, 00:20

... Treatment Center, AL-Amodi Autism Research Chair, Department of Physiology, Faculty of Medicine, King Saud University, Riyadh, Saudi Arabia and 2Department of Pediatrics, Faculty of Medicine, Ain ... Shams University, Cairo, Egypt Corresponding Author: Gehan Ahmed Mostafa Address: Ahmed El-Samman Street off Makram Ebaid, Nasr City, Cairo, Egypt E-mail.: hafezg@softhome.net, gehan_mostafa@hotmail.com ... inflammation encompasses a series of vascular and non-vascular inflammatory responses, triggered by the activation of primary sensory neurons, with a subsequent release of inflammatory neuromediators...

Ngày tải lên: 19/06/2014, 22:20

... Health Canada, has denied compassionate access use to DAM, HAT treatment is unavailable in Canada Canada is the only country where diamorphine has been tested for addiction treatment and has ... approved and, at this point, only have approval for a RCT using MMT as an active comparator In Switzerland, the provision of HAT was approved after a referendum was passed and the German trial went ahead ... announcing the start of the trial, the study has received considerable attention in local, national and international media While media interest can be beneficial in raising the profile of harm...

Ngày tải lên: 11/08/2014, 18:20

... (Aa) B GST-pulldown assay, using the NS1 proteins shown in panel A C Histogram showing the collated results of at least such assays Mapping the the PDZ domain of Dlg targeted by NS1 A number of ... but all are shown in Figure 3A for ease of reference These were used in pull-down assays with the in vitro translated avian, human and Aa mutant NS1 proteins The results of a representative assay ... with the non-PDZ-binding mutant of Avian NS1 (Aa), plus the avian human-like (Ah) and the human avian-like (Ha) mutants Lower panel GST pulldown assay using these NS1 proteins To address these...

Ngày tải lên: 11/08/2014, 21:21

... Analyzing the dynamics within the team The effectiveness and success of a team have close relationship with the dynamics within the team Because if the team has suitable dynamics, members of team and ... group work and team work Finally, the task of evaluation work is to offer insightful analysis of options, so the characteristics which are suitable to this work of the team are strategic and discerning ... separate works which are planning, research, implementation, control and evaluation The characteristics of candidates who apply for team have to meet the characteristic of these works Firstly, the...

Ngày tải lên: 03/04/2013, 12:11

... because of your environment James and Tiana both started at an insurance company on the same day two years ago There were five other newbies who started with them, but they all seemed kind of vanilla, ... at him again Tiana doesn’t know what she’ll if Laura and James get together She longs for the day when James gets a job at another company, because maybe then she could work up the courage to ... dodgeball tournament She was pretty and nice and seemed to like him back They started dating and things were going well At a party soon after Sam and Cara started seeing each other, Sam ran into Katie,...

Ngày tải lên: 10/02/2014, 18:17

... pain and inflammation Metastasis (plural: metastases, verb: metastasize): The spread of cancer cells throughout the body The cancer cells that have spread to other parts of the body are the same ... bones release calcium Lung cancer that has spread to bone can also cause an increased release of calcium from the site of the tumor Hypercalcemia occurs when the amount of calcium in the blood ... is a rare dental condition It is an area of exposed jaw bone that shows no sign of healing after eight weeks The condition can cause feelings of pain or numbness in the affected area As most cases...

Ngày tải lên: 15/02/2014, 05:20

... be able to easily communicate changes in their signal area They need to easily change and verify their coverage information so that off-air and web broadcasts are ALWAYS identical BENEFITS OF AIR-TO-WEB ... ensure that the underlying signal area data is always accurate The benefits to the consumers and the broadcasters are many Local broadcasters will be able to bring their programming to the Internet, ... over -the- air broadcasts to American families, and because of the value of localism in broadcasting Localism, a principle underlying the broadcast service since the Radio Act of 1927, serves the...

Ngày tải lên: 18/02/2014, 00:20

... disequilibria and debt accumulation in the periphery This imbalance became unsustainable, and this unsustainability was a causal factor in the global financial crisis of 2007– 08 The paper also maintains ... combined with the financial crisis, implied a collapse of output and a fiscal crisis The inability   9  to depreciate the nominal exchange rate, and the absence of a supra-national fiscal authority ... in the absence of nominal exchange rate depreciation, the adjustment of the balance of payments must be carried by variations in the level of activity   8  Figure Contraction and appreciation Although...

Ngày tải lên: 06/03/2014, 19:20

... wouldn’t know a newspaper if the paperboy hit them in the face Reality: More than a quarter of U.S teens say they read a daily newspaper and more than a third say they read on Sunday As some newspapers ... movies in the theater the highest average theatrical viewing of any age group Put differently, teens made up 14% of the theatrical movie going audience in 2008 and 20% of the critical “heavy” moviegoing ... TV ads are 44% more likely to say they liked the ad • Teens play video games, but are as excited about play-along music games and car-racing games as they are about violent ones: Just two of their...

Ngày tải lên: 23/03/2014, 03:20

... lacks stan- the capabilities of a crawler program humans may derive the metadata, which dards that would facilitate automated Another drawback of automated in- can then be attached to a Web page ... and the rest of the Internet constitute a gigantic storehouses of raw information and analysis, the database of all databases Worries about the future of the Net usually center on the delays and ... called pages, that can be accessed subject matter (This information is ent areas of its database, a disparate over the network The Web crawlers known as metadata.) A Web crawler collection of...

Ngày tải lên: 12/05/2014, 15:21

... debating alternatives Some of these new schemes are as simple as placing a tax on carbon emissions, while others, such as “cap and dividend” or “cap and invest,” are really variations of the ... tape has restrained the expansion of refineries, construction of new pipelines and Alaskan Drilling: Small Area, Big Potential Alaska ANWR CANADA This circle is the size of This circle is the size ... drastically As it happens, the past several thousand years of recorded human history have been strangely mild The changes we are currently experiencing are well within the known natural variations...

Ngày tải lên: 29/06/2014, 04:20

... compelled to create a botanical extravaganza behind your house Instead, as city dwellers do, and take advantage of public parks and gardens There, professional landscapers all the hard work, leaving you ... spaces add up to a big space, and we can actually move around again Take advantage of all that newfound space and a little happy dance! What we need to keep in mind (and which is way too easy ... exhilarating You arrive at your destination, leap off the plane, and zip by the crowds awaiting their luggage You then jump on the subway, catch a bus, or start walking in the direction of your...

Ngày tải lên: 20/07/2014, 21:23

... plant adapts its absolute growth rate to a linear nitrate dosage, as to PFR, through adaptation of the size The data fore, suggest that of the apex, casu quo of the vascular system The increase ... that the absolute growth adapts in a way similar to that of nitrate dosage As the availability of (reduced) nitrate in the plant becomes limiting, the expansion of the vascular system stops and ... depended also mainly upon the P/N-quotient As expected, NR-act declined with the (relative) availability of nitrate and with (mean) age of the (increasing) group of older mature leaves The NR-act of...

Ngày tải lên: 09/08/2014, 04:20

... available to allow the appropriate calculations As the rather disparate examples in Figures to show, it is unusual to have a coherent set of data available for a single topic because the amount ... dose of drug was allowed in the data, and the table additionally shows the rate and frequency of additional events The calculations used a mortality rate of 10% for gastrointestinal bleeding and ... J, Saperas E, Santolaria S, Rodrigo L, Balanzo J, Bajador E, Almela P, Navarro JM, Carballo F, Castro M, Quintero E, Investigators of the Asociacion Espanola de Gastroenterologia (AEG): A nationwide...

Ngày tải lên: 09/08/2014, 10:23

... http://www.jmedicalcasereports.com/content/4/1/28 Page of Figure Parathyroid carcinoma lymphovascular invasion parathyroid carcinoma over a 12-year period The clinical presentation of the disease in these five patients was varied The imaging ... At the time of operation, a haemorrhagic cyst with a parathyroid gland within it was visualised A biopsy was taken from the left upper parathyroid gland Histology revealed a cm parathyroid carcinoma ... Metastatic parathyroid carcinoma: dilemmas in management Surgery 1991, 110:978-988 Clayman GL, Gonzales HE, El Naggar A, Vassilopoulou R: Parathyroid carcinoma: evaluation and interdisciplinary...

Ngày tải lên: 11/08/2014, 14:21