... -MASSPTKILCDAGESDLCRDDAAAFLLKFVAIASIL 1:MFFIDVLWKLFPLYLFGSERDYLSETESILKIVPETMAAASSLSILCDAGEPDLCRDDSAAFLLKLVAIASIF TjZNT1 TjZNT2 37:LAGVAGVAIPLIGKNRRFLQTEGNLFVAAKAFAAGVILATGFVHMLAGGTEALTNPCLPDYPWSKFPFPGFFA ... in YNB medium at 30 °C, and imaged with a laser scanning confocal microscope (FV 1000; Olympus, Tokyo, Japan) Metal accumulation assay The Cd2+ accumulation assay was performed as described in ... were harvested, washed twice, and resuspended in an ice-cold assay buffer (LZM-EDTA) Then, the attenuance of the cell suspensions was measured Cells were incubated in the assay buffer containing...
Ngày tải lên: 29/03/2014, 00:20
... TTGGTTCGCGATCTGAATTCGTCAAGTCCACCTC-3¢ The primers used for H26 7A were: oBQ144-2, 5Â-CACT CGGTACTCCGCAGCGTTTCGCCGTTARCCATTGAA TATTTGCACAATATGG-3Â (R ẳ purine); and oBQ145-2, 5Â-CCATATTGTGCAAATATTCAATGGYTAACGGCG ... was termed pPL9b CphBm was amplified from genomic DNA from PCC7601 using primers oBQ146 (5¢-TATACCATGG GCTTAAGTCCTGAAAATTCTCCAG-3¢) and oBQ147 (5¢-AAACTCGAGCCGGCCCTCAATTTTGACCTCCTGC AATGTGAAATAGAACG-3¢), ... other cyanobacteria [9], e.g Calothrix PCC7601 [10] and Anabaena PCC7120, and also in proteobacteria such as Deinococcus radiodurans, Pseudomonas aeruginosa [3,11] and Agrobacterium tumefaciens...
Ngày tải lên: 30/03/2014, 08:20
Tài liệu Creative economy as a development strategy a view of developing countires doc
... Piedras Feria 142 The creative economy and the development possibilities in Argentina Facundo Solanas 160 Creative economy as a strategy for Jamaica and the Caribbean growth and wealth generation ... products and services will be sent abroad.” On the other hand, Latin America and the Caribbean together did not exceed a 3% market share, whereas Australasia and Africa accounted for 1% of global exports ... and capillarity to economy as a whole Acknowledging its role is essential to drive the creative economy as a development strategy, for two basic aspects First, as they already are the largest...
Ngày tải lên: 14/02/2014, 08:20
Smoking and reproduction: The oviduct as a target of cigarette smoke ppt
... had a picomolar LOAEL in the ciliary beat frequency assay Many of the compounds in Table were also screened using a chick chorioallantoic membrane (CAM) assay that measures growth of the CAM and ... oviduct: a regulator of local contraction and gamete transport J Cardiovasc Pharmacol 2004, 44 Suppl 1:S248-51 111 Wijayagunawardane MP, Miyamoto A, Taquahashi Y, Acosta TJ, Nishimura M, Sato K: Angiotensin ... femtomolar range (Table 1) In general, if a chemical were inhibitory, it acted in all three bioassays, although the potency and efficacy for a particular chemical varied among the assays Some of the...
Ngày tải lên: 05/03/2014, 17:20
Báo cáo khoa học: "Solving Relational Similarity Problems Using the Web as a Corpus" potx
... 2.3 Paraphrase Acquisition Our method of extraction of paraphrasing verbs and prepositions is similar to previous paraphrase acquisition approaches Lin and Pantel (2001) extract paraphrases from ... verbal analogy problems, yielding 47% accuracy The same approach is applied to classifying noun-modifier pairs: using the Diverse dataset of Nastase and Szpakowicz (2003), Turney&Littman achieve ... (container, content, equative, material, measure, topic, type) For example, exam anxiety is classified as effect and therefore as CAUSALITY, and blue book is property and therefore also PARTICIPANT...
Ngày tải lên: 08/03/2014, 01:20
Searching for a Mate: The Rise of the Internet as a Social Intermediary potx
... Kennedy and Davis 1993), but gay bars were not always safe or pleasant, and the bars inevitably reached only a small percentage of the local gay and lesbian communities Compared to the gay bar, the ... survey was offered only in English, whereas the ACS was offered in a variety of languages Asians and Hispanics are the two groups that contribute most to racial and ethnic intermarriage in the US ... postdated the Internet revolution by more than a decade, the data offer a unique opportunity to assess the impact of the Internet on the way Americans meet their romantic partners The fact that Americans...
Ngày tải lên: 15/03/2014, 21:20
A Portrait of the Artist as a Young Man ppt
... trigonometry That was very far away First came the vacation and then the next term and then vacation again and then again another term and then again the vacation It was like a train going in and out ... It was only for cod I’m sorry The face and the voice went away Sorry because he was afraid Afraid that it was some disease Canker was a disease of plants and cancer one of animals: or another ... dead things The prefect was there again and it was his voice that was saying that he was to get up, that Father Minister had said 22 A Portrait of the Artist as a Young Man he was to get up and...
Ngày tải lên: 31/03/2014, 14:20
báo cáo hóa học:" The PedsQL™ as a patient-reported outcome in children and adolescents with Attention-Deficit/Hyperactivity Disorder: a population-based study" pdf
... DataStat, a nationally-based survey administration firm located in Michigan, was contracted to administer the California SCHIP statewide mail survey DataStat mailed the PedsQL™ 4.0 survey, together ... (22.2%) Hispanic/Latino, (9.7%) Black/African American, (9.7%) Asian/Pacific Islander, 2(2.8%) Native American or Native Alaskan, and (12.5%) missing The statewide SCHIP sample was representative of ... design, and performed the statistical analysis All authors read and approved the final manuscript Acknowledgements This research was supported by a grant from the David and Lucile Packard Foundation...
Ngày tải lên: 20/06/2014, 15:20
Báo cáo toán học: " Code choice in the Chinese as a foreign language classroom" pot
... English as a lingua franca in teaching Chinese as a foreign language: A case study of native Chinese teachers in Beijing In Language alternation, language choice and language encounter in international ... strategies”); and as a heritage and community language in the diasporas across the world, such as the United States (Xiao Yun 2011; Xing 2009; Chen, Wang and Cai 2010) and Britain (Li and Zhu 2011; ... Charlene, and Patricia Duff 1994 Teachers’ language use in university foreign language classrooms: A qualitative analysis of English and target language alternation The Modern Language Journal...
Ngày tải lên: 20/06/2014, 21:20
Báo cáo hóa học: " Biofabrication of Anisotropic Gold Nanotriangles Using Extract of Endophytic Aspergillus clavatus as a Dual Functional Reductant and Stabilizer" potx
... P, Ahmad A, Mandal D, Senapati S, Sainkar SR, Khan MI, Ramani R, Parischa R, Kumar PAV, Alam M, Sastry M, Kumar R: Angew Chem Int Ed 2001, 40:3585 14 Ahmad A, Senapati S, Khan MI, Kumar R, Ramani ... biomass-based reduction Characterization of Gold Nanotriangles Experimental Details Isolation of Endophytic Aspergillus clavatus The host plant Azadirachta indica A Juss was surveyed, and samples ... Srinivas V, Sastry M: Nanotechnology 2003, 14:824 15 Gade AK, Bonde PP, Ingle AP, Marcato P, Duran N, Rai MK: J Biobased Mat Bioener 2008, 2:1 16 Vigneshwaran N, Ashtaputre NM, Varadarajan PV, Nachane...
Ngày tải lên: 21/06/2014, 08:20
báo cáo hóa học:" Code choice in the Chinese as a foreign language classroom" pptx
... English as a lingua franca in teaching Chinese as a foreign language: A case study of native Chinese teachers in Beijing In Language alternation, language choice and language encounter in international ... strategies”); and as a heritage and community language in the diasporas across the world, such as the United States (Xiao Yun 2011; Xing 2009; Chen, Wang and Cai 2010) and Britain (Li and Zhu 2011; ... Charlene, and Patricia Duff 1994 Teachers’ language use in university foreign language classrooms: A qualitative analysis of English and target language alternation The Modern Language Journal...
Ngày tải lên: 21/06/2014, 17:20
Báo cáo hóa học: "Code choice in the Chinese as a foreign language classroom" potx
... English as a lingua franca in teaching Chinese as a foreign language: A case study of native Chinese teachers in Beijing In Language alternation, language choice and language encounter in international ... strategies”); and as a heritage and community language in the diasporas across the world, such as the United States (Xiao Yun 2011; Xing 2009; Chen, Wang and Cai 2010) and Britain (Li and Zhu 2011; ... Charlene, and Patricia Duff 1994 Teachers’ language use in university foreign language classrooms: A qualitative analysis of English and target language alternation The Modern Language Journal...
Ngày tải lên: 21/06/2014, 19:20
The Project Gutenberg E Book of The Argentine as a Market, by N. L. Watson potx
... rise as, in all probability they will, a rise in wages will be imperative This, in the case of railways would mean an increase in rates, as there are few who are earning more than a reasonable ... the work on the spot, and, as capital is usually forthcoming, the estancias are run in such a way as to yield the greatest possible return They are usually well-maintained, up-to-date in management ... seed alfalfa is sown as well When the last crop has been cut, the latter grows through the stubble The growth of this plant is such that as alfalfa is more cultivated, the stock-bearing capacities...
Ngày tải lên: 28/06/2014, 19:20
The Manager as a Planner and Strategist pdf
... & Mauritz, and England’s Jaeger and Laura Ashley, have attempted to supply fashionable clothes at lower prices, none has succeeded as well as Spanish clothes maker, Zara, whose sales have soared ... recent The Manager as a Planner and Strategist 277 years.51 Zara has managed to position itself as the low price/cost leader in the fashion segment of the clothing market because of the way it ... products and uses a different marketing approach than its North American division Global and multidomestic strategies both have advantages and disadvantages The major advantage of a global strategy...
Ngày tải lên: 05/07/2014, 19:20
Báo cáo khoa hoc:" The chicken as a model to study microchromosomes in birds: a review" potx
... metaphase preparations and usually classified by decreasing size (17! Except for the Falconiformes and particularly the Accipitridae family which has no more than three to six microchromosome pairs ... consider them as ancestral chromosomes although they are very rare in fish and batracians Indeed, they could have been inherited from a common ancestor of the vertebrates, as they can be encountered ... making it a reference for the detailed study of bird genomes THE CHICKEN KARYOTYPE Although the boundary between macro- and microchromosomes varies according to authors, the actual standard karyotype...
Ngày tải lên: 09/08/2014, 18:21
báo cáo khoa học: " Osteonecrosis of the jaw as a possible rare side effect of annual bisphosphonate administration for osteoporosis: A case report" ppsx
... by mild to moderate pain on palpation A panoramic radiograph and cone beam computed tomography identified radiolucent areas at the resected apices of teeth 22 and 23 as well as the region surrounding ... Oral Maxillofac Surg 2003, 61(9):1115-1117 Advisory Task Force on Bisphosphonate-Related Osteonecrosis of the Jaws, American Association of Oral and Maxillofacial Surgeons: American Association ... TB, Assael LA, Landesberg R, Marx RE, Mehrotra B: American Association of Oral and Maxillofacial Surgeons position paper on bisphosphonate-related osteonecrosis of the jaws–2009 update J Oral Maxillofac...
Ngày tải lên: 10/08/2014, 23:20
Báo cáo y học: "Menstruating from the umbilicus as a rare case of primary umbilical endometriosis: a case report" pot
... endometriotic glands with mucinous type metaplasia and extravasation of the mucinous secretion into the adjacent stroma (Figure 1) No epithelial atypia was seen and the excision appeared complete The patient ... Endometriomas appear homogeneously hyperintense on T1-weighted sequences [10] MRI also has an advantage over laparoscopy for evaluating pelvic and extraperitoneal diseases, as well as lesions concealed ... of the mucinous Umbilical endometriosis: endometriotic glands with metaplasia of the mucinous type and extravasation of the mucinous secretion into the adjacent stroma Majority of these cases...
Ngày tải lên: 11/08/2014, 14:21
báo cáo khoa học:" The ICF as a common language for rehabilitation goal-setting: comparing client and professional priorities" ppt
... across the nine ICF activities and participation domains The Friedman analysis is a nonparametric statistical test which is an alternative to the repeated analysis of variance measure Statistical ... cm cardboard, cut out and laminated and velcro was attached to the back for easy placement on a regular short pile mat These line drawings could then be placed by the participants on the mat under ... its design, statistical analysis and drafted the manuscript MG and AVDM participated in its design, data collection and statistical analysis All authors read and approved the final manuscript Competing...
Ngày tải lên: 12/08/2014, 00:20
Báo cáo y học: "Genomic studies of mood disorders - the brain as a muscle" pot
... Futamura T, Toyooka K, Iritani S, Niizato K, Nakamura R, Tsuchiya K, Someya T, Kakita A, Takahashi H, Nawa H: Abnormal expression of epidermal growth factor and its receptor in the forebrain and ... state and leaves open the possibility that the opposite may be true that FGFs may be increased - in more manic states, giving an overall mixed picture in brains from bipolar patients As a caveat, ... of mania [20] Anabolic steroids, which not only increase muscle mass but also increase the levels of growth factors such as insulin-like growth factor in many parts of the body [21], also have...
Ngày tải lên: 14/08/2014, 14:21