system architecture of delta sigma a d converters

... DoC is obtained, and that is a linearized version of Do K is a gain factor which sets the bandwidth of the filter, determining the tradeoff between speed and accuracy 3.1 DIGITAL BACKGROUND CALIBRATION ... suitable range (a Gaussian distribution with a 0.2% standard deviation has been assumed) We have considered an input signal composed of tones around the center of the Nyquist bandwidth The random sequence ... is a ected by errors in the interstage gain R (called radix), due to capacitor mismatch, finite opamp gain, and incomplete settling Digi- ··· MDAC ··· MDAC k Vi,k + R − ADC SHA MDAC N Vo,k DAC Dk...

Ngày tải lên: 22/06/2014, 19:20

... 10 media and storage capacity-floppies, hard disk, MO disc, DAT, CD-ROM, CD-R and CD writ able Unit-2: various package and programs Computer Software-Operating Systems and Development packages, ... on all units and will carry 10 marks Syllabus Unit-1 : Taxation: Indian Tax system - allocative and equity of individual taxes, benefit and ability to pay approaches, direct and indirect taxes ... data analysis, Information processing, modeling and graphical presentation The advancements for PC software and declining prices of hardware are the key factors for their widespread use in education,...

Ngày tải lên: 31/03/2014, 03:20

... shared data structure available to all database threads and/or processes When a thread needs a page to be read in from the database, it generates an I/O request specifying the disk address, and ... which manages all data access (read) and manipulation (create, update, delete) calls The storage system includes algorithms and data structures for organizing and accessing data on disk (“access ... Introduction Database Management Systems (DBMSs) are complex, mission-critical software systems Today’s DBMSs embody decades of academic and industrial research and intense corporate software development...

Ngày tải lên: 20/02/2014, 05:21

... Annals of Mathematics, 158 (2003), 679–710 Approximating a bandlimited function using very coarsely quantized data: A family of stable sigma -delta modulators of arbitrary order By Ingrid Daubechies ... INGRID DAUBECHIES AND RON DEVORE , Approximating a bandlimited function using very coarsely quantized data: Improved error estimates in sigma -delta modulation, J Amer Math Soc., to appear ¨ ¨ ... References [1] A R Calderbank and I Daubechies, The pros and cons of democracy, IEEE Trans Inform Theory 48 (2002), 1721–1725 [2] J C Candy and G C Temes (Editors), Oversampling Delta- Sigma Data Converters ...

Ngày tải lên: 05/03/2014, 23:20

... rubra du Roi) and seeds of acacias (Acacia albida Del., A holosericea) were germinated on the same substrate (a homogeneous mixture of sandy clay and peat) in minirhizotrons with replicate plants ... visible apical n + order laterals to the axis tip) Statistical studies of these ture are data allow the determination of elongation laws and branching patterns They may then be integrated into a deterministic ... Taproot elongation is always linear and non-rhythmic, with a daily rate of about 1.4-1.9 cm /d for oaks, 1.2 cm /d for A holosericea and albida (Table 1) 1.5-2.2 cm /d for A Taproot branching patterns...

Ngày tải lên: 09/08/2014, 02:21

... basic concepts involved in analog-to-digital conversion and in a Sigma -Delta modulator has an ADC are looked upon The different types of Σ∆M are also discussed along with their respective advantages ... that such a very high frequency is ever tried in CMOS bandpass Sigma Delta ADC However, literature search shows that CMOS bandpass Sigma Delta modulators realized in the past were up to a maximum ... modulator, to eliminate slope overload Hence the name Sigma Delta Modulator”, Sigma to denote the integrator, followed by a Delta Modulator”, was probably given to the system The idea of...

Ngày tải lên: 26/09/2015, 10:51

... volume was calculated as the sum of inflow and rainfall minus evapotranspiration Because the paddy field had a hardpan (impermeable layer) under the plow layer (i.e., the topsoil) and the groundwater ... Agricultural Hydrology, Kyoritsu Shuppan Co., Ltd, Tokyo (in Japanese) Mays P A and Edwards G S (2001) Comparison of heavy metal accumulation in a natural wetland and constructed wetlands receiving acid ... wetland Therefore, this wetland has been planted with Zizania latifolia Turcz (Manchurian wild rice), which, unlike reeds, causes little damage to the paddy field and has a high biomass production...

Ngày tải lên: 05/09/2013, 10:15

... intermediates shown in (A) : AEEAFDL for intermediates 1, 4a, 4b, 4d, 6a and 6c; CPVAAGECA for intermediates 6b and 6d; and PALA for intermediate 4c Western blot analysis with an antibody against ETA ... WSEWASGKVLCLLDPLDGVYNYLAQQRCNLDDTWEGKIYRVLAGNPAKHDLDIKPTVISHRL HFPEGGSLAALTAHQACHLPLETFTRHRQPR279 280 ETA -A GWEQLEQCGYPVQRLVALYLAARLSWNQVDQV IRNALASPGSGGDLGEAIREQPEQARLALTLAAAESERFVRQGTGNDEAGAANADVVSLTCP ... ETA The arrows to the left and right indicate the mobilities of intact ETA ( 66 kDa), ETA -A ( 37 kDa), and unknown degradation fragments absence of ATP revealed a small amount of degradation...

Ngày tải lên: 18/02/2014, 04:20

... sequence of conomarphin The signal peptide is shadowed and the mature peptide is underlined The polyA signal AATAAA in the 3¢-UTR is also underlined The cDNA of conomarphin has been deposited in ... Kumagaye KY, Nakajima K, Watanabe T, Kawai T, Kawakami Y, Niidome T, Sawada K, Nishizawa Y et al (1994) Omega-agatoxinTK containing D- serine at position 46, but not synthetic omega-[L-Ser46]agatoxin-TK, ... protection N-terminal sequencing and MS N-terminal amino acid sequence analysis was performed by automated Edman degradation on an ABI model 49 1A Procise Protein Sequencing System (Applied Biosystems,...

Ngày tải lên: 18/02/2014, 17:20

... GCGGGATCCGTGAATAATCTGCACCCTCGA ATAAGAATGCGGCCGCTCAAGGCAGCTCGCTCTCCTTTTT GCGGGATCCCTCAGCCCATTGGAAGGCACC ATAAGAATGCGGCCGCTCAGCTGTCACTCAGCCGCAGCAG GCGGGATCCAACAAGGAAGAACCCCCC ATAAGAATGCGGCCGCTCAGTCTGAGGTGATAACATTCCC ... GCGAAGCTTCACGATGCCCAAGAAGAAGCCGACGCC GCGGGATCCCGGATGCTGGCAGCGTGGGTTGG GCGGGATCCAACAAGGAAGAACCCCCC ATAAGAATGCGGCCGCTCAAGGCAGCTCGCTCTCCTTTTT GCGGGATCCCTCAGCCCATTGGAAGGCACC ATAAGAATGCGGCCGCTCAAGGCAGCTCGCTCTCCTTTTT ... ATAAGAATGCGGCCGCTCAAAGCTTGATTTTGAATTCTG GCGAAGCTTCACGATGTCTCACACCATTT GCGGGATCCCGTTTCCCAGCCTGTTGGGCCT AAACTGCAGGATGGCGGACATCTCCCTGGAC AAACTGCAGAAGCTTGATTTTGAATTCTGT AAACTGCAGGATGGCGGACATCTCCCTGGAC AAACTGCAGAAGCTTGATTTTGAATTCTGT...

Ngày tải lên: 19/02/2014, 05:20

... that AdjA1 and AdjA2 are mutually reinforcing The combination is indexed on AdjA1+AdjA2 Example: “as dark and sophisticated as a chocolate martini” (3) AdjA NounS where NounS denotes a cultural ... of adjectival properties used by Veale and Hao (2007), we harvest all instances of the patterns “as ADJ and * as” and “as * and ADJ as” from Google, noting the combinations that are found and ... and the adjective AdjA denotes a property that mutually reinforces an unstated but salient property AdjSA of the stereotype Example: “as cold as a wet haddock” The combination is indexed on AdjSA...

Ngày tải lên: 20/02/2014, 05:20

Ngày tải lên: 23/02/2014, 04:20

... possible that a large part of CagA is unfolded during and after translocation, although more studies are necessary to decipher the structural details of this process Although structural data are accumulating ... composed of a 70 residues N-terminal trans-membrane segment (absent in the crystal structure) and two domains, a nucleotide binding domain and an all-adomain TrwB binds to ATP at the interface between ... gene-pathogenicity island (cagPAI), a 40 kbp DNA fragment that is transmitted horizontally; see the accompanying review by Tegtmeyer et al [14 ] CagA is considered as a paradigm for bacterial carcinogenesis...

Ngày tải lên: 06/03/2014, 00:21

... rigid distinctions of caste and race made by Br[ =a] hmanical pride, and to the startling novelty of an enthusiastic religious propaganda among all classes and races in India, and outside India to ... favourite of fortune; and as soon as he had discovered that a young lady of Emesa in Syria had a royal nativity[56] he solicited and obtained her hand Julia Domna[57] (for that was her name) deserved ... hosts of Xerxes; they invaded Thessaly and fought at Plataea From the time of Alexander onwards there was direct and constant contact between [ =A] ry[ =a] varta and the kingdoms of the successors of...

Ngày tải lên: 07/03/2014, 03:20

... chieftain Madockawando and was highly esteemed by the savages It was at the instigation of St Castin and Madockawando that the Indians determined to take the war path The first notable incident of ... caribou and red deer roamed in savage freedom Wild fowl of all kinds abounded along the marsh, and interval lands of the St John, and the river itself undisturbed by steamboats and unpolluted ... command by land and sea, appoint officers of government and justice, keep such lands as he fancied and grant the remainder to his vassals He had also a monopoly of the fur trade and with Fort la...

Ngày tải lên: 08/03/2014, 13:20

... manifold treasonable practices that they have kindled and plotted in this country, are discharged to come home again under pain of treason, after their receiving of the said orders abroad; and ... is stated that a hundred Monks and Jesuits accompanied the expedition; while Cardinal Allen, an Englishman, was appointed superintendent of ecclesiastical affairs throughout England After having ... stated, that he had acknowledged, under his own hand, that Greenway had asked him who should be protector? and that he had replied that the matter was to be deferred until the blow was actually...

Ngày tải lên: 08/03/2014, 22:20

... and all plant tissue above ground was used for the analyses (A) Total RNA was extracted and 20 lg RNA was loaded in each lane and blotted as indicated in Experimental procedures To prove equal ... were determined according to [56] using BSA as a protein standard The DNA and amino acid sequence analyses and prediction of the molecular masses were performed with the programs mapdraw and protean ... such as amino acid oxidases, transaminases, and racemases (epimerases) For example, in pea seedlings the occurrence of d- amino acid aminotransferase was demonstrated [36] For a number of other amino...

Ngày tải lên: 16/03/2014, 18:20

... targeted at the revised scenario and the updated system capabilities—for example, an additional dialogue quality measure will assess how often the goal-inference system was able to detect and correctly ... M A Walker, D J Litman, C A Kamm, and A Abella 1997 PARADISE: A framework for evaluating spoken dialogue agents In Proceedings of ACL/EACL 1997 ACL Anthology P971035 K Papineni, S Roukos, T Ward, ... http://www.euprojects-jast.net/ http://www.ics.forth.gr/indigo/ 886 D J Litman and S Pan 2002 Designing and evaluating an adaptive spoken dialogue system User Modeling and User-Adapted Interaction, 12(2–3):111–137...

Ngày tải lên: 17/03/2014, 01:20

... Substrate VanXYCa D5 9S D5 9A VanXYCa D5 9S D5 9A D- Ala -D- Ala a D- Ala -D- Ala D- Ala -D- Ala UDP-MurNAc-pentapeptide[Ala] UDP-MurNAc-pentapeptide[Ala] UDP-MurNAc-pentapeptide[Ala] Km (mM) kcat (s)1) kcat/Km ... plots of His6 –VanXYC for (A) D- Ala -D- Ala; (B) D- Ala -D- Ser; (C) UDP-MurNAc-pentapeptide[Ala] rates of hydrolysis of D- Ala -D- Ala and UDP-MurNAcpentapeptide[Ala] by His6–VanXYC are lower than those ... nucleotide peptide substrate UDP-MurNAc-pentapeptide[Ala] (3.3 mM) was used instead of D- Ala -D- Ala EDTA did not affect the D- amino acid oxidase assay at a concentration of 0.05 mM and below To...

Ngày tải lên: 18/03/2014, 01:20

... & Yamada C, Unpublished), using forward primer 5¢-CATATGGATGAGTACAAACA AGTAGATG-3¢ and reverse primer 5¢-GGATCCTCGAG CTCATTTACGTTTTAAATTAATGCCGAT-3¢ (underlined sequences indicate NdeI and BamHI ... Quikchange Site-Directed Mutagenesis kit (Stratagene, La Jolla, CA, USA) with forward primer 5¢-GAAACGATGC ATTTGTCCTATGCCGACCGTGCGTC-3¢ and reverse primer 5¢-GACGCACGGTCGGCATAGGACAAATGCA TCGTTTC-3¢ ... c-glutamyltranspeptidase K Wada et al not only c-glutamyl compound-degrading activity (GGT activity) but also the steady glutaminase activity [16] that converts glutamine into glutamic acid and ammonia...

Ngày tải lên: 22/03/2014, 21:20