synthesizing metal nanoparticles in a water in co2 microemulsion

Báo cáo hóa học: " Synthesis of NaYF4:Yb3+, Er3+ upconversion nanoparticles in normal microemulsions" pdf

Báo cáo hóa học: " Synthesis of NaYF4:Yb3+, Er3+ upconversion nanoparticles in normal microemulsions" pdf

... and maintaining this temperature for h After annealing, the particles aggregated into larger clusters (Figure 4A) , and the XRD pattern (Figure 4B) shows that hexagonal NaYF4:Yb3+, Er3+ phase emerged ... microemulsions water/ ethanol/NaOA/OA mixture with a constant volume fraction For example, we begin from point A, and reach a critical point C where the solution starts showing a two-phase character The result ... Characterization data for NaYF4: 20% Yb3+, 2% Er3+ UCNPs (A) TEM image (Inlet: HRTEM image of a single nanocrystal) (B) XRD pattern of the sample and the calculated line pattern for cubic phase...

Ngày tải lên: 20/06/2014, 22:20

5 481 0
The effects of clay a m e n d m e n t and composting on metal speciation in digested sludge liang qiao

The effects of clay a m e n d m e n t and composting on metal speciation in digested sludge liang qiao

... Ni, but the plant available Pb was dramatically decreased The finding is similar to that of Garcia et al ,(1990) who extracted more plant available metals by DTPA after composting of aerobic digested ... mobility and plant availability of Pb were significantly reduced, because the leachability and plant availability of metals can be expressed as the exchangeable, carbonates and oxides bound metal species ... solid waste These variations in the quantity and quality of humic substances also influenced the speciation of heavy metals Relationship of metal speciation and leachable metal Since a M MgC12...

Ngày tải lên: 23/09/2012, 14:47

14 1K 0
Tài liệu Báo cáo khoa học: Involvement of two positively charged residues of Chlamydomonas reinhardtii glyceraldehyde-3-phosphate dehydrogenase in the assembly process of a bi-enzyme complex involved in CO2 assimilation doc

Tài liệu Báo cáo khoa học: Involvement of two positively charged residues of Chlamydomonas reinhardtii glyceraldehyde-3-phosphate dehydrogenase in the assembly process of a bi-enzyme complex involved in CO2 assimilation doc

... PsativumA SoleraceaA 197 Chlamy 200 Synechocystis 198 Synechococcus 199 R R R R R R R R R R R R R R R R R R R R A A A A A A A A A A R R R R R R R R R R A A A A A A A A A A A A A A A A A A A A A ... T T T T T G G G G G G G G G G A A A A A A A A A A A A A A A A A A A A K K K K K K K K K K A A A A A A A A A A V V V V V V V V V V S S S S A A A S A A L L L L L L L L L L V V V V V V V V V V L ... with a rabbit antiserum directed against recombinant C reinhardtii CP12 (1 : 2000) or a rabbit antiserum directed against recombinant C reinhardtii GAPDH (1 : 5000) Antibody binding was revealed...

Ngày tải lên: 19/02/2014, 16:20

8 494 0
A meta analysis and risk assessment of heavy metal uptake in common garden vegestable

A meta analysis and risk assessment of heavy metal uptake in common garden vegestable

... higher than the RDA are taken over a long period, anemia and damage to the pancreas and kidney can develop Vomiting, diarrhea, abdominal cramping, and, in some cases, intestinal hemorrhage can occur ... literature was searched, using PubMed and Infotrac databases, for articles pertaining to heavy metal contamination of soils and uptake by plants with no limitation on publication date Certain criteria ... outlined in RAGS are given in Table 19 Table 1: Data Evaluation Steps Outlined in the USEPAs Risk Assessment Guidance for Superfund (RAGS) (EPA 1989) Gather all data available from the site investigation...

Ngày tải lên: 15/03/2014, 23:10

64 482 0
Báo cáo khoa học: Metal exchange in metallothioneins – a novel structurally significant Cd5 species in the alpha domain of human metallothionein 1a ppt

Báo cáo khoa học: Metal exchange in metallothioneins – a novel structurally significant Cd5 species in the alpha domain of human metallothionein 1a ppt

... also includes amino acids not found in the native protein The four divalent metal ions are labeled as 1, 5, and in accordance with the original NMR numbering for two-domain mammalian metallothionein ... N, GonzalezDuarte R, Atrian S & Gonzalez-Duarte P (1997) Recombinant synthesis of mouse Zn3-beta and Zn4-alpha metallothionein domains and characterization of their cadmium(II) binding capacity ... [19] The available X-ray, NMR and CD data are consistent with the Cd4(Scys)11 cluster in the a domain being adamantane-like in structure Thus, the Cd 4a domain observed from many mammalian species...

Ngày tải lên: 16/03/2014, 06:20

13 439 0
Báo cáo Y học: Nuclear proteins that bind to metal response element a (MREa) in the Wilson disease gene promoter are Ku autoantigens and the Ku-80 subunit is necessary for basal transcription of the WD gene ppt

Báo cáo Y học: Nuclear proteins that bind to metal response element a (MREa) in the Wilson disease gene promoter are Ku autoantigens and the Ku-80 subunit is necessary for basal transcription of the WD gene ppt

... nuclear extracts were incubated with avidin–agarose beads (Sigma) at °C for 30 to eliminate materials in the extracts that bind nonspecifically to the beads After removing the beads by filtration, ... 30 at 25 °C After elinimating by centrifugation denatured proteins generated during the binding reaction, the mixture was combined with 20 lL avidin–agarose beads and incubated at room temperature ... were incubated with a biotinylated MREa oligonucleotide and trapped by avidin– agarose beads The proteins were extracted from the avidin– agarose beads by washing with a buffer containing 0.5 M...

Ngày tải lên: 17/03/2014, 23:20

11 628 0
Báo cáo khoa học: Identification of the N-terminal region of TjZNT2, a Zrt⁄Irt-like protein family metal transporter, as a novel functional region involved in metal ion selectivity ppt

Báo cáo khoa học: Identification of the N-terminal region of TjZNT2, a Zrt⁄Irt-like protein family metal transporter, as a novel functional region involved in metal ion selectivity ppt

... -MASSPTKILCDAGESDLCRDDAAAFLLKFVAIASIL 1:MFFIDVLWKLFPLYLFGSERDYLSETESILKIVPETMAAASSLSILCDAGEPDLCRDDSAAFLLKLVAIASIF TjZNT1 TjZNT2 37:LAGVAGVAIPLIGKNRRFLQTEGNLFVAAKAFAAGVILATGFVHMLAGGTEALTNPCLPDYPWSKFPFPGFFA ... Plates were incubated at 30 °C for days (B) Yeast cell Zn2+ uptake was measured with 65Zn Cells were incubated in LZM-EDTA containing 10 lM ZnCl2 at 30 °C for 10 Data are means ± standard deviations ... caerulescens as a model system Ann Bot 102, 3–13 Weber M, Harada E, Vess C, Roepenack-Lahaye E & Clemens S (2004) Comparative microarray analysis of Arabidopsis thaliana and Arabidopsis halleri roots...

Ngày tải lên: 29/03/2014, 00:20

8 343 0
Báo cáo hóa học: " In Situ Loading of Basic Fibroblast Growth Factor Within Porous Silica Nanoparticles for a Prolonged Release" ppt

Báo cáo hóa học: " In Situ Loading of Basic Fibroblast Growth Factor Within Porous Silica Nanoparticles for a Prolonged Release" ppt

... S Suzuki, M Tanihara, Y Mizushima, M Dezawa, J Biomed Mater Res A 7 1A, 661– 668 (2004) Y Tabata, K Yamada, S Miyamoto, I Nagata, H Kikuchi, I Aoyama, M Tamura, Y Ikada, Biomaterials 19, 807–815 ... bFGF-loaded MSNs was around 0.126 mg measured by a 0.001 mg balance Nanoparticles Characterization Mesoporous silica nanoparticles (MSNs) used for encapsulating bFGF were further investigated by ... assay buffer This reagent was added to a 96-well plate After at least 30 of incubation at 37 °C, the resulting fluorescent signals for the living cell and dead cells were measured at an excitation...

Ngày tải lên: 22/06/2014, 00:20

6 307 0
Báo cáo hóa học: "Photochemically reduced polyoxometalate assisted generation of silver and gold nanoparticles in composite films: a single step route" pptx

Báo cáo hóa học: "Photochemically reduced polyoxometalate assisted generation of silver and gold nanoparticles in composite films: a single step route" pptx

... S Shanmugam, B Viswanathan, T.K Varadarajan, J Mol Catal A 241 52 (2005) 25 M.G Vagara, E Papaconstantinou, M.T Pope, Inorg Chem 9, 662 (1970) 26 S Shanmugam, B Viswanathan, T.K Varadarajan, ... metal nanoparticles was characterized with various physicochemical techniques As such no reports are available at present for embedding the Ag and Au nanoparticles in organic–inorganic nanocomposite ... with Ag nanoparticles is golden yellow in color and Au embedded composite film has a pink color The rate of formation of Ag nanoparticles is higher than the Au nanoparticles The surface plasmon band...

Ngày tải lên: 22/06/2014, 22:20

9 385 0
metal oxide nanoparticles in organic solvents

metal oxide nanoparticles in organic solvents

... hexahydrate Co(acac)3 Co2 (CO)8 OA, OLA, ODA OA, DA or OLA Ethanol, alkylamines, PVP OA, TOA, diphenyl ether Various high-boiling solvents, OLA OLA, OA Octadecylamine 1-Hexadecene, OLA, octadecylamine ... (Eur J Inorg Chem 2008, 825) Without any doubts, metal oxide nanoparticles play an outstanding role in many applications that are regarded as particularly promising within the broad area of Nanotechnology, ... of water In comparison to aqueous sol-gel chemistry, the list of potential precursors is longer and includes, in addition to inorganic metal salts and metal alkoxides, also metal acetates and metal...

Ngày tải lên: 02/07/2014, 11:36

230 328 0
towards a rational design for sustainable urban drainage systems understanding (bio)geochemical mechanisms for enhanced heavy metal immobilization in filters

towards a rational design for sustainable urban drainage systems understanding (bio)geochemical mechanisms for enhanced heavy metal immobilization in filters

... natural drainage routes and permeable surfaces while at the same time increasing contaminant load from surface water runoff This contaminant laden runoff has the potential to be discharged into ... defence against contaminants in road runoff Thus, media filtration in stormwater treatment is increasingly being used as a best management practice Filter drains rely on basic principles of filtration ... used in numerous applications such as potable water and wastewater treatment (Dorea et al 2004) A straightforward process allowing contaminated water to flow through filter media has shown an improvement...

Ngày tải lên: 22/12/2014, 17:08

232 230 0
investigation the heavy metal contents in surface water and sediment collected in thadluang marsh

investigation the heavy metal contents in surface water and sediment collected in thadluang marsh

... wetland area) in recent years The remaining area is covered with permanent and seasonal aquaculture ponds, shrub and grassland, and peat land [NUOL, March, 2002] Water draining into the ThadLuang ... exploiting area The main reason leading to heavy metals pollution is pouring into water environment a large amount of industrial and untreated wastewater Pollution by heavy metals accumulated through ... seen in rivers near industrial area, big cities and minerals exploiting area The main reason leading to heavy metals pollution is pouring into water environment a large amount of industrial and...

Ngày tải lên: 09/01/2015, 08:53

69 250 0
In vitro and in vivo investigation of nanoparticles of a novel copolymer for substained and controlled delivery of docetaxel

In vitro and in vivo investigation of nanoparticles of a novel copolymer for substained and controlled delivery of docetaxel

... resistance protein (BCRP), that usually cause the low oral bioavailability of most antineoplastic drugs (Malingré et al., 2001; Schinkel and Jonker, 2003; Varma et al., 2003; Varma and Panchagnula, ... 1: INTRODUCTION 1.1 Background There has been a sustained interest during recent years in developing localized and sustained treatment for cancer and other fatal diseases such as cardiovascular ... is a general group of natural compounds which contain basic nitrogen atoms in the molecular structure Two sub-groups of alkaloids that have the antitumor capability are vinca alkaloids and taxanes...

Ngày tải lên: 09/10/2015, 11:18

163 932 0
Effect of urban emissions on the horizontal distribution of metal concentration in sediments in the vicinity of Asian large cities

Effect of urban emissions on the horizontal distribution of metal concentration in sediments in the vicinity of Asian large cities

... lead concentration in the water phase associated with suspended matters, surface water samples were taken from Laguna Lake, Pasig River and at its branches, San Juan River and Marikina River in ... untreated wastewater contained higher concentrations of lead and zinc The data on the metal concentration of wastewater in the Philippines is not available In the case of other countries, Karvelas ... runoff may have similar contamination Conclusion Metal contents in sediments in Manila Bay – Laguna Lake watershed in the Philippines were measured and detailed horizontal distribution was obtained...

Ngày tải lên: 05/09/2013, 09:08

11 441 0
Spatial Variation of Metal Concentrations in Watercourses of an Urban River Basin in Southeastern Brazil

Spatial Variation of Metal Concentrations in Watercourses of an Urban River Basin in Southeastern Brazil

... Hussain et al., 2008) CA is also carried out to identify any analogous behavior among different sampling stations or among measured variables in a dataset from a monitoring program (Mendiguch a ... establishing pollutant load–reduction goals and water- quality management strategies In this study, data from the Velhas River basin monitoring program have been analyzed through hierarchical CA ... in water was analyzed using an atomic absorption spectrometer The quantification of metals was based upon calibration curves of standard solutions of each metal The precision of the analytical...

Ngày tải lên: 05/09/2013, 10:15

14 520 1
Comparision metal analysis in sediments using EDXRF and ICP OES with the HCl and tessie extraction metho

Comparision metal analysis in sediments using EDXRF and ICP OES with the HCl and tessie extraction metho

... NH4 OAc and ml of ultra-pure water were added and shaken in a water- bath at 85 ± ◦ C for 30 The residues were washed in 20 ml ultra-pure water after each extraction phase and totally transferred ... the metals obtained by ICP-OES technique that in an operational way were identified as potentially available fra1 fra2 fra3 fra4 fra1+2+3+4 fra2 fra4 fra1+2+3+4 0,1 mol/L HCl and sequential extractions ... That may be explained by inspection of the concentration values in Table In that month, a meaningful decrease in the concentrations of all potentially available metals was verified Barreto et al...

Ngày tải lên: 15/03/2014, 23:22

10 1,1K 0
Effect of sludge processing mode, soil texture and soil ph on metal mobility in undisturbed soil columns

Effect of sludge processing mode, soil texture and soil ph on metal mobility in undisturbed soil columns

... are elevated and contaminants have a high a nity for the mobile colloids Xiao et al (1999) reported ash/sludge mixtures as having elevated DOM concentrations that increased trace metal leachability, ... Alkalinestabilized sludge (NV; N-ViroTM process) was obtained from the Waste Stream Environmental facility at the Onondaga County wastewater plant Detailed processing information and analyses, including ... two heavy loading cycles (Cycles and 4) of 100 tons/ha DW sludge each, to rapidly attain cumulative metals loading in the soil to simulate long-term applications This phase allowed rapid attainment...

Ngày tải lên: 16/03/2014, 00:07

20 489 0
Estimation method for contribution of emission to trace metal concentrations in urban atmosphere based o

Estimation method for contribution of emission to trace metal concentrations in urban atmosphere based o

... of waste containing lead in refuse incineration plants ● Annual Mean Values at 16 Stations of the National Air Surveillance Network (from literature) * Mean Value at Refuse Incineration Plants ... refuse incineration, implying that almost of the total amount of Cd in the atmosphere originates from refuse incineration as in the case of Pb Dust from Other Sources Lead Concentration Lead Concentration ... Concentration and Lead Isotope Ratios in Atmosphere literature) ▲ △ Mean Ratios of Fly Ashes from Refuse Incineration (n = 7, measured) While the lead concentration in the atmosphere substantially...

Ngày tải lên: 16/03/2014, 00:07

2 350 0
w