specific changes in the total rna content of intraerythrocytic p falciparum

Báo cáo y học: "The ''''permeome'''' of the malaria parasite: an overview of the membrane transport proteins of Plasmodium falciparum" pdf

Báo cáo y học: "The ''''permeome'''' of the malaria parasite: an overview of the membrane transport proteins of Plasmodium falciparum" pdf

... on the basis of the hydropathy plots of the corresponding proteins [9] The approach is based on the observation that the polypeptides comprising transporter proteins typically possess multiple ... 67:79-89 Pattanaik P, Jain B, Ravindra G, Gopi HN, Pal PP, Balaram H, Balaram P: Stage -specific profiling of Plasmodium falciparum proteases using an internally quenched multispecificity protease ... number of putative/ proven P falciparum- encoded transport proteins to 109 Of Predicting the cellular localization of P falciparum transport proteins Many transport proteins are located at the surface...

Ngày tải lên: 14/08/2014, 14:21

22 384 0
Investigating the cytoadherence of plasmodium falciparum infected red blood cells

Investigating the cytoadherence of plasmodium falciparum infected red blood cells

... cells KAHRP knob associated histidine rich protein PAM pregnancy-associated malaria PfEMP1 Plasmodium falciparum RBC membrane protein PfEMP3 Plasmodium falciparum RBC membrane protein PS phosphatidylserine ... protein - PfEMP1, is exported to the iRBC membrane The internal domain of PfEMP1 binds to KAHRP and PfEMP3, and the external binding domains are extruded out of the knob structure It acts as the adhesion ... and it was pre-warmed before the experiment d Fluorescent Staining of PfEMP1 on IRBCs The staining of surface expressed PfEMP1 of FCR3CSA strain followed the description in previous publications...

Ngày tải lên: 09/09/2015, 18:52

147 354 0
Atomic force microscopy study of malaria infected red blood cells

Atomic force microscopy study of malaria infected red blood cells

... drawing of a typical force curve with a rupture peak arising from specific interaction between the tip-bound receptor and the cell-expressed ligand Step A: At the beginning of tip approaching ... Further retraction induces the cantilever to bend in the other direction due to the bond holding the tip to the cell surface The nonlinear extension part represents the stretching of polymer linker ... in 1880 Four species of Plasmodium spp commonly infect humans: Plasmodium (P. ) falciparum, P vivax, P ovale and P malariae with the first two being most widespread (account for 95% of total infection)...

Ngày tải lên: 11/09/2015, 14:34

196 628 0
Báo cáo y học: "ene expression analysis of human red blood cells"

Báo cáo y học: "ene expression analysis of human red blood cells"

... I,II,III, zinc/PHD fingerDNA-binding proteins, cysteinyl, lysyl-tRNA synthetase), important RNA- stabilising factor - poly(A) binding protein, anti-apoptotic proteins (for instance beclin 1, reticulon ... meaning of these findings But gene expression profiling of human erythrocyte could be an important key for understanding the machinery of anucleate protein synthesis and its meaning in the pathophysiology ... factor, caspase Other authors were able to show a protein synthesis in human platelets by megakaryocyte-derived mRNAs 19 The finding of RNA in anucleate cells like erythrocytes support the idea of nucleus...

Ngày tải lên: 03/11/2012, 10:58

4 399 0
Tài liệu Báo cáo khoa học: Glycomics-based analysis of chicken red blood cells provides insight into the selectivity of the viral agglutination assay docx

Tài liệu Báo cáo khoa học: Glycomics-based analysis of chicken red blood cells provides insight into the selectivity of the viral agglutination assay docx

... the detection of two different cross peaks at 4.58 and 4.54 p. p.m and approximately 99 p. p.m as a result the presence of GlcNAc-5&5¢ and GlcNAc-7 respectively The cross HPLC profiling of 2-aminobenzamide ... lactosamine repeats before the terminal sialylation step instead of simply desialylating and resialylated cRBCs In addition to improving the use and interpretation of RBC agglutination assay, the present ... anomeric proton of GlcNAc-2 appears at 4.62 p. p.m.; the GlcNAc-5 and GlcNAc-5¢ anomeric protons appear at 4.56–4.59 p. p.m The signal at 4.54 p. p.m can be attributed to the anomeric proton of GlcNAc-7;...

Ngày tải lên: 14/02/2014, 19:20

14 812 0
Báo cáo khoa học: V1–Varia V1-001P Hemolysis of human red blood cells by riboflavin-Cu(II) system: enhancement by azide. ppt

Báo cáo khoa học: V1–Varia V1-001P Hemolysis of human red blood cells by riboflavin-Cu(II) system: enhancement by azide. ppt

... to ascertain development of rhythmical profile in PER1 protein production and effect of the photoperiod on daily profiles in Per1 expression and PER1 protein production in the rat SCN during ontogenesis ... well as the double mutant in these residues Furthermore, a PCR-amplified part of the atoC gene encoding the C-terminal of the protein (amino acids 140– 461) lacking the phosphorylation domain, has ... photosensitizer in photodynamical therapy of tumors because of its high photosensitizing activity in vitro and in vivo The cooperative binding of Pheo to model polycationic polypeptide matrix, poly-l-Lysine...

Ngày tải lên: 30/03/2014, 20:20

31 319 0
Báo cáo khoa học: "Nucleated red blood cells in the blood of medical intensive care patients indicate increased mortality risk: a prospective cohort study" doc

Báo cáo khoa học: "Nucleated red blood cells in the blood of medical intensive care patients indicate increased mortality risk: a prospective cohort study" doc

... NRBCs in the peripheral blood of patients in the medical intensive care unit was investigated with regard to its prognostic power for in- hospital mortality The incidence of NRBC-positive patients ... analysis and interpretation of data MK was responsible for the writing of the manuscript All authors read and approved the final manuscript Page of (page number not for citation purposes) Critical ... alanine aminotransferase, C-reactive protein, and the prothrombin time ratio was performed As a result, the independent prognostic power of NRBCs is under- Page of (page number not for citation purposes)...

Ngày tải lên: 13/08/2014, 03:21

8 314 0
Báo cáo y học: " Age of red blood cells and mortality in the critically ill" ppsx

Báo cáo y học: " Age of red blood cells and mortality in the critically ill" ppsx

... RBC -specific data included the age of the RBC unit at the time of transfusion and the leukodepletion status The age of the blood was determined by subtracting the date of collection from the ... in drafting and revision of the manuscript All authors were involved in data acquisition, and read and approved the final manuscript Competing interests EMW is a full-time employee of the Australian ... assess the independent relationship between the age of RBCs and hospital mortality in a heterogeneous population of critically ill patients Nonetheless, our findings must be seen in light of three...

Ngày tải lên: 14/08/2014, 08:21

8 406 0
Atomic force microscope imaging of human red blood cells and theri mechanical properties

Atomic force microscope imaging of human red blood cells and theri mechanical properties

... over the sample The purpose of using this mode is to prevent the AFM tip from being trapped by the ‘capillary force’ caused by the extremely thin film of water surrounding samples in air ‘Tapping ... transporter linkage The ratio of spectrin dimers to ankyrin in the RBC suggests that, on average, each spectrin tetramer is linked to the anion transporter by a single ankyrin Spectrin-actin interactions ... Protein 4.1 increases the binding of spectrin to actin by an allosteric mechanism that increases spectrin affinity for actin 1.2 Micro-rheology of RBC membrane With proper theoretical interpretation,...

Ngày tải lên: 30/09/2015, 14:23

88 117 0
phosphatidylserine exposure in red blood cells: a suggestion for the active role of red blood cells in blood clot formation

phosphatidylserine exposure in red blood cells: a suggestion for the active role of red blood cells in blood clot formation

... Invitrogen) The antibody against human antigen PLSCR3 is a polyclonal antibody The immunogenic sequence contains 295 amino acids: MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSPGP VALGSAAPFLPLPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQP ... gradient The aminophospholipid flippase is perhaps the most selective of the lipid transporters It prefers PS over other lipids [42, 44] and the specificity for PS is defined by each of the functional ... Methods F Investigation of the kinetics of PS exposure To investigate the kinetics of the PS exposure processes, the washed RBCs were put on a coverslip in physiological solution in the presence of...

Ngày tải lên: 15/11/2015, 12:54

151 581 0
Báo cáo y học: "Extra-cellular release and blood diffusion of BART viral micro-RNAs produced by EBV-infected nasopharyngeal carcinoma cells" pps

Báo cáo y học: "Extra-cellular release and blood diffusion of BART viral micro-RNAs produced by EBV-infected nasopharyngeal carcinoma cells" pps

... data are in favour of plasma BART miRNAs existing under both forms, a point that will deserve further investigations on a larger group of patients In terms of physiopathology, the finding of stable ... primer specific of each microRNA Each stem-loop primer has a specific linear portion complementary of the 3’ end of the target microRNA and a loop portion containing a universal invariant target ... cases In contrast, the 2-ΔCT was very low for miR-BART1- 5p There was no miR-BART detection in the pool of plasma samples from CAPI mice Detection of BART miRNAs in the plasma of NPC patients To demonstrate...

Ngày tải lên: 12/08/2014, 01:22

12 341 0
báo cáo hóa học:" Discovery and implementation of transcriptional biomarkers of synthetic LXR agonists in peripheral blood cells" pptx

báo cáo hóa học:" Discovery and implementation of transcriptional biomarkers of synthetic LXR agonists in peripheral blood cells" pptx

... regulated in human PBMC by LXR-623, including steroyl-CoA desaturase [37], apolipoproteins C1 and C2 [38], phospholipid transfer protein [39], low density lipoprotein receptor [40], apolipoprotein E ... element binding transcription factor phospholipid transfer protein apolipoprotein C-II low density lipoprotein receptor (familial hypercholesterolemia) nuclear receptor subfamily 1, group H, member ... measured in vivo by monitoring the expression of selected LXR target genes in peripheral blood cells This approach should prove useful for future clinical development of the present compound and other...

Ngày tải lên: 18/06/2014, 15:20

15 624 0
Báo cáo hóa học: " Role of protease-activated receptor-2 on cell death and DNA fragmentation in Helicobacter pylori-infected gastric epithelial cells" ppt

Báo cáo hóa học: " Role of protease-activated receptor-2 on cell death and DNA fragmentation in Helicobacter pylori-infected gastric epithelial cells" ppt

... Soybean trypsin inhibitor (SBTI) suppresses H pyloriinduced activation of MAPK in gastric epithelial cells H pylori -induced increases in phospho -specific forms of p3 8, ERK1/2, and JNK1/2 were inhibited ... proteins other than PARs, antiapoptotic proteins such as inhibitors -of- apoptosisproteins (IAPs) were induced by NF-B activation and protected the cells from apoptosis induced by the wildtype H pylori ... the possible relations of the expression of PAR-2, the activation of MAPK, and apoptosis in H pylori-infected gastric epithelial cells The present study aims to investigate whether H pylori-induced...

Ngày tải lên: 18/06/2014, 16:20

7 400 0
Báo cáo hóa học: " The effect of red blood cell transfusion on tissue oxygenation and microcirculation in severe septic patients" pdf

Báo cáo hóa học: " The effect of red blood cell transfusion on tissue oxygenation and microcirculation in severe septic patients" pdf

... revising the manuscript, and approving the manuscript in its final form RT contributed to analyzing the data and interpreting the results, revising the manuscript, and approving the manuscript in its ... to conceiving the study, acquiring and managing the data, analyzing the data and interpreting the results, drafting and revising the manuscript, and approving the manuscript in its final form ... transfusion-induced changes in NIRVO2, in the recovery upslope of the reperfusion phase, in PPV, and in MFI were all in the same direction, suggesting that an improvement or worsening in microvascular...

Ngày tải lên: 20/06/2014, 22:20

11 587 0
Báo cáo hóa học: " Red blood cell transfusion in the critically ill patient" docx

Báo cáo hóa học: " Red blood cell transfusion in the critically ill patient" docx

... as the storage lesion” [57] This includes intracellular changes (progressive depletion of 2,3-diphosphoglycerate [2,3DPG] with increased affinity of hemoglobin for oxygen, depletion of ATP), ... the manuscript The manuscript was revised for intellectual content by JLV Both authors read and approved the final manuscript 19 Competing interests The authors declare that they have no competing ... anemia or in bleeding patients in whom RBC administration can increase both oxygen arterial content and cardiac output However, in the absence of bleeding, the increase in hemoglobin concentration...

Ngày tải lên: 20/06/2014, 23:20

9 477 0
Cell Membrane: The Red Blood Cell as a Model ppt

Cell Membrane: The Red Blood Cell as a Model ppt

... and epigenetic modification, the expression of mRNA, protein synthesis in the Golgi apparatus, protein precursors and their isoforms, trafficking of proteins in cytoplasm in the cell, incorporation ... High-density-lipoprotein Cholesterol (mg dLÀ1) 50 e 11 Phospholipids (%) Lysophosphatidylcholine Phosphatidylcholine Sphingomyelin Phosphatidylethanolamine Phosphatidylserine ‡ phosphatidylinositol Others ... PC) Phosphatidylcholine (PC) Sphingomyelin (SM) Phosphatidylethanolamine (PE) Phosphatidylserine (PS) ‡ phosphatidylinositol (PI) PC ‡ SM ‡ L-PC/PE ‡ PS ‡ PI FC/PL ratio SM/PC ratio 1202 e 103...

Ngày tải lên: 29/06/2014, 11:20

449 819 0
Báo cáo khoa học: "Red blood cell elution time of strains of Newcastle disease virus" pptx

Báo cáo khoa học: "Red blood cell elution time of strains of Newcastle disease virus" pptx

... ,epolevne lariv eht no xelpmoc a mrof esadainimaruen dna ninitulggameh eht ecniS nietorpocylg ninitulggameh eht ni seudiser surivoxymarap a fo yticinegohtap eht taht detroper ]8[ nretS yticinegohtap ... elbatsomreht fo noitcudorP WJ dnalopoC ,BP worbdarpS 9991 ,nodnoL ,sserP cimedacA ,0311 p de dn2 ,ygoloriV fo aidepolcycnE ).sde( GR htbeW ,A ffonarG :nI esaesid eltsacweN CK atpuG ,A rentroP 6791,805-424 ... ecneluriv rof ecnacifingis sti dna snieorpocylg lariv eht fo egavaelc cityloetorP R ttoR ,DH knelK ,Y iagaN 1791 ,488-678 ,651 cossA deM teV mA J ainepokuelnap enilef fo yduts eht rof serudecorp lacigoloreS...

Ngày tải lên: 07/08/2014, 18:21

2 294 0
Báo cáo khoa học: " Hematology, cytochemistry and ultrastructure of blood cells in fishing cat (Felis viverrina)" ppt

Báo cáo khoa học: " Hematology, cytochemistry and ultrastructure of blood cells in fishing cat (Felis viverrina)" ppt

... ,selunarg epahs-dor htiw lihponisoe na )B & A( :slihponisoE SAP rof evitisop ylgnorts )G( ulg-β rof deniats ylevitisop )F( EANA rof evitisop ylkaew )E( ylevitcepser ,BBS dna REP ,slihportuen evitisop ... evitisop )G( ylevitcepser ,ulg-β dna EANA rof evitisop )F & E( BBS ,)tfel( lihportuen deniats ylevitisop a ot derapmoc )thgir( lihposab deniats ylevitagen a )D( REP rof evitagen )C( W htiw msalpotyc ... :setycohpmyL ylevitcepser ,SAP dna ulg-β ,EANA rof evitisop )G & F ,E( BBS ,)thgir( lihportuen evitisop ylgnorts ot derapmoc )tfel( etyconom fo selunarg kcalb wef a htiw evitisop ylthgils )D( REP rof...

Ngày tải lên: 07/08/2014, 20:23

6 213 0
Báo cáo y học: "Decreased response to IL-12 and IL-18 of peripheral blood cells in rheumatoid arthritis" doc

Báo cáo y học: "Decreased response to IL-12 and IL-18 of peripheral blood cells in rheumatoid arthritis" doc

... cytokine response in joints of patients with longstanding RA [13] IL-18 is a proinflammatory cytokine that plays an important role in the Th1-type immune response through the induction of IFN-γ ... macrophage production of inflammatory cytokines such as TNF-α [20] To control some of the potentially deleterious properties of IL-18, IL-18-binding protein (IL-18BP) has been identified as a specific ... without ng/ml of IL-12, ng/ml of IL-18, µg/ml of IL-18 binding protein (IL-18BP), or a combination of these (b) Cells were activated with 200 ng/ml of phytohemagglutinin (PHA) and ng/ml of phorbol...

Ngày tải lên: 09/08/2014, 01:23

7 324 0
Báo cáo y học: "Gene profiling in white blood cells predicts infliximab responsiveness in rheumatoid arthritis" potx

Báo cáo y học: "Gene profiling in white blood cells predicts infliximab responsiveness in rheumatoid arthritis" potx

... CytP450, family 3, subfamily A, polypeptide 417137 A kinase (PRKA) anchor protein 415079 Hypothetical protein DKFZp566M1046 1848509 RP1 containing part of thyroid hormone receptorassociated protein ... the paired subsets and Page of 11 (page number not for citation purposes) Gene profiling in pre-treatment PBMCs correlates with treatment responsiveness Gene profiling in PBMCs was studied in the ... with the resulting and beneficial eradication of the non-responder or moderate responder phenotypes Competing interests A patent application EP 06290789.4 for the set of 20 or transcripts with predictive...

Ngày tải lên: 09/08/2014, 08:22

11 322 0
w